Recombinant Human CCDC126 Protein, GST-Tagged
| Cat.No. : | CCDC126-0521H |
| Product Overview : | Human CCDC126 full-length ORF (NP_620126.2, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CCDC126 (Coiled-Coil Domain Containing 126) is a Protein Coding gene. GO annotations related to this gene include alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity. An important paralog of this gene is MGAT5B. |
| Molecular Mass : | 42.1 kDa |
| AA Sequence : | MFFTISRKNMSQKLSLLLLVFGLIWGLMLLHYTFQQPRHQSSVKLREQILDLSKRYVKALAEENKNTVDVENGASMAGYADLKRTIAVLLDDILQRLVKLENKVDYIVVNGSAANTTNGTSGNLVPVTTNKRTNVSGSIR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCDC126 coiled-coil domain containing 126 [ Homo sapiens ] |
| Official Symbol | CCDC126 |
| Synonyms | CCDC126; coiled-coil domain containing 126; coiled-coil domain-containing protein 126; FLJ23031; MGC104248; |
| Gene ID | 90693 |
| mRNA Refseq | NM_138771 |
| Protein Refseq | NP_620126 |
| UniProt ID | Q96EE4 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC126 Products
Required fields are marked with *
My Review for All CCDC126 Products
Required fields are marked with *



