Recombinant Human CCDC134 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CCDC134-1350H
Product Overview : CCDC134 MS Standard C13 and N15-labeled recombinant protein (NP_079097) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : CCDC134 (Coiled-Coil Domain Containing 134) is a Protein Coding gene.
Molecular Mass : 26.6 kDa
AA Sequence : MDLLQFLAFLFVLLLSGMGATGTLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRISRSQSELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CCDC134 coiled-coil domain containing 134 [ Homo sapiens (human) ]
Official Symbol CCDC134
Synonyms CCDC134; coiled-coil domain containing 134; dJ821D11.3; coiled-coil domain-containing protein 134
Gene ID 79879
mRNA Refseq NM_024821
Protein Refseq NP_079097
MIM 618788
UniProt ID Q9H6E4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCDC134 Products

Required fields are marked with *

My Review for All CCDC134 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon