Recombinant Human CCDC134 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CCDC134-1350H |
Product Overview : | CCDC134 MS Standard C13 and N15-labeled recombinant protein (NP_079097) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | CCDC134 (Coiled-Coil Domain Containing 134) is a Protein Coding gene. |
Molecular Mass : | 26.6 kDa |
AA Sequence : | MDLLQFLAFLFVLLLSGMGATGTLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRISRSQSELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CCDC134 coiled-coil domain containing 134 [ Homo sapiens (human) ] |
Official Symbol | CCDC134 |
Synonyms | CCDC134; coiled-coil domain containing 134; dJ821D11.3; coiled-coil domain-containing protein 134 |
Gene ID | 79879 |
mRNA Refseq | NM_024821 |
Protein Refseq | NP_079097 |
MIM | 618788 |
UniProt ID | Q9H6E4 |
◆ Recombinant Proteins | ||
CCDC134-656R | Recombinant Rhesus monkey CCDC134 Protein, His-tagged | +Inquiry |
CCDC134-0525H | Recombinant Human CCDC134 Protein, GST-Tagged | +Inquiry |
Ccdc134-1991M | Recombinant Mouse Ccdc134 Protein, Myc/DDK-tagged | +Inquiry |
CCDC134-1599H | Recombinant Human CCDC134 Protein (Thr23-Leu229), C-His tagged | +Inquiry |
CCDC134-499H | Recombinant Human CCDC134 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC134-1685HCL | Recombinant Human CCDC134 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC134 Products
Required fields are marked with *
My Review for All CCDC134 Products
Required fields are marked with *