Recombinant Human CCDC134 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CCDC134-1350H | 
| Product Overview : | CCDC134 MS Standard C13 and N15-labeled recombinant protein (NP_079097) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | DDK&Myc | 
| Description : | CCDC134 (Coiled-Coil Domain Containing 134) is a Protein Coding gene. | 
| Molecular Mass : | 26.6 kDa | 
| AA Sequence : | MDLLQFLAFLFVLLLSGMGATGTLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRISRSQSELTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
| Concentration : | 50 μg/mL as determined by BCA | 
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. | 
| Gene Name | CCDC134 coiled-coil domain containing 134 [ Homo sapiens (human) ] | 
| Official Symbol | CCDC134 | 
| Synonyms | CCDC134; coiled-coil domain containing 134; dJ821D11.3; coiled-coil domain-containing protein 134 | 
| Gene ID | 79879 | 
| mRNA Refseq | NM_024821 | 
| Protein Refseq | NP_079097 | 
| MIM | 618788 | 
| UniProt ID | Q9H6E4 | 
| ◆ Recombinant Proteins | ||
| CCDC134-656R | Recombinant Rhesus monkey CCDC134 Protein, His-tagged | +Inquiry | 
| CCDC134-0525H | Recombinant Human CCDC134 Protein, GST-Tagged | +Inquiry | 
| Ccdc134-1991M | Recombinant Mouse Ccdc134 Protein, Myc/DDK-tagged | +Inquiry | 
| CCDC134-1599H | Recombinant Human CCDC134 Protein (Thr23-Leu229), C-His tagged | +Inquiry | 
| CCDC134-499H | Recombinant Human CCDC134 Protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CCDC134-1685HCL | Recombinant Human CCDC134 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC134 Products
Required fields are marked with *
My Review for All CCDC134 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            