Recombinant Human CCDC144NL Protein, GST-tagged
| Cat.No. : | CCDC144NL-5300H |
| Product Overview : | Human MGC87631 full-length ORF ( NP_001004306.1, 1 a.a. - 221 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CCDC144NL (Coiled-Coil Domain Containing 144 Family, N-Terminal Like) is a Protein Coding gene. |
| Molecular Mass : | 50.2 kDa |
| AA Sequence : | MASWGGEKRGGAGGSPKPAVYATRKTPSVGSQEDQWYLDYPGDQWSLGFSYSWWKNSVGSESKHGEGALDQLQHDVRLEDLGELHRAARSGDVPGVEHVLAPGDTGVDKRDRKKSIQQLVPEYKEKQTPESLPQNNNPAAPSQAEGGEGGVACGTVEQMTWLCSLPHAVGGGDGDHSSTGAVGGHPRGPGEYCHLHEQRVHHHIFARGKRKGKNHVSNVVR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCDC144NL coiled-coil domain containing 144 family, N-terminal like [ Homo sapiens (human) ] |
| Official Symbol | CCDC144NL |
| Synonyms | CCDC144NL; coiled-coil domain containing 144 family, N-terminal like; putative coiled-coil domain-containing protein 144 N-terminal-like |
| Gene ID | 339184 |
| mRNA Refseq | NM_001004306 |
| Protein Refseq | NP_001004306 |
| UniProt ID | Q6NUI1 |
| ◆ Recombinant Proteins | ||
| CCDC144NL-5300H | Recombinant Human CCDC144NL Protein, GST-tagged | +Inquiry |
| CCDC144NL-6445HF | Recombinant Full Length Human CCDC144NL Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCDC144NL-7776HCL | Recombinant Human CCDC144NL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC144NL Products
Required fields are marked with *
My Review for All CCDC144NL Products
Required fields are marked with *
