Recombinant Human CCDC42 Protein, GST-Tagged

Cat.No. : CCDC42-0550H
Product Overview : Human CCDC42 full-length ORF (AAH29224.1, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CCDC42 (Coiled-Coil Domain Containing 42) is a Protein Coding gene. An important paralog of this gene is CFAP73.
Molecular Mass : 55.4 kDa
AA Sequence : MSLGIMEEEDLAEYFRLQYGERLLQMLQKLPNVEGASESPSIWLLEKKKETEIMHQTMVQKKKMFQRRMETLNLRWEELGVKEAQLKAHIQKSEQFIQENDQKRIRAMKKANKERELKCQHMQELTKRKQEMVALRLEHQRLSAKLKDYYIFNKYLEKVVENSEESRWAHIQNTAAKKTLLLGTIKMATLNLFQIVSKHLKEVTEVALEDTHKQLDMIQQFIQDRSDIWAEVKKKEQQRVRI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCDC42 coiled-coil domain containing 42 [ Homo sapiens ]
Official Symbol CCDC42
Synonyms CCDC42; coiled-coil domain containing 42; coiled-coil domain-containing protein 42A; CCDC42A; FLJ32734;
Gene ID 146849
mRNA Refseq NM_001158261
Protein Refseq NP_001151733
UniProt ID Q96M95

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCDC42 Products

Required fields are marked with *

My Review for All CCDC42 Products

Required fields are marked with *

0
cart-icon