Recombinant Human CCDC68 Protein, GST-Tagged
| Cat.No. : | CCDC68-0571H |
| Product Overview : | Human CCDC68 full-length ORF (NP_079490.1, 1 a.a. - 335 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CCDC68 (Coiled-Coil Domain Containing 68) is a Protein Coding gene. Diseases associated with CCDC68 include Cutaneous T Cell Lymphoma. |
| Molecular Mass : | 65.3 kDa |
| AA Sequence : | MTTVTVTTEIPPRDKMEDNSALYESTSAHIIEETEYVKKIRTTLQKIRTQMFKDEIRHDSTNHKLDAKHCGNLQQGSDSEMDPSCCSLDLLMKKIKGKDLQLLEMNKENEVLKIKLQASREAGAAALRNVAQRLFENYQTQSEEVRKKQEDSKQLLQVNKLEKEQKLKQHVENLNQVAEKLEEKHSQITELENLVQRMEKEKRTLLERKLSLENKLLQLKSSATYGKSCQDLQREISILQEQISHLQFVIHSQHQNLRSVIQEMEGLKNNLKEQDKRIENLREKVNILEAQNKELKTQVALSSETPRTKVSKAVSTSELKTEGVSPYLMLIRLRK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCDC68 coiled-coil domain containing 68 [ Homo sapiens ] |
| Official Symbol | CCDC68 |
| Synonyms | CCDC68; coiled-coil domain containing 68; coiled-coil domain-containing protein 68; cutaneous T cell lymphoma associated antigen; SE57 1; CTCL tumor antigen se57-1; CTCL-associated antigen se57-1; cutaneous T-cell lymphoma associated antigen; cutaneous T-cell lymphoma-associated antigen se57-1; SE57-1; FLJ25368; |
| Gene ID | 80323 |
| mRNA Refseq | NM_001143829 |
| Protein Refseq | NP_001137301 |
| MIM | 616909 |
| UniProt ID | Q9H2F9 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC68 Products
Required fields are marked with *
My Review for All CCDC68 Products
Required fields are marked with *
