Recombinant Human CCDC8 protein, GST-tagged

Cat.No. : CCDC8-301361H
Product Overview : Recombinant Human CCDC8 (60-196 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Glu60-Glu196
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization
AA Sequence : EKSTPHPPQPPKKPKEPRVRRRVQQMVTPPPRLVVGTYDSSNASDSEFSDFETSRDKSRQGPRRGKKVRKMPVSYLGSKFLGSDLESEDDEELVEAFLRRQEKQPSAPPARRRVNLPVPMFEDNLGPQLSKADRWRE
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name CCDC8 coiled-coil domain containing 8 [ Homo sapiens ]
Official Symbol CCDC8
Synonyms CCDC8; coiled-coil domain containing 8; coiled-coil domain-containing protein 8; 3M3; DKFZp564K0322; PPP1R20; protein phosphatase 1; regulatory subunit 20; protein phosphatase 1, regulatory subunit 20; p90;
Gene ID 83987
mRNA Refseq NM_032040
Protein Refseq NP_114429
MIM 614145
UniProt ID Q9H0W5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCDC8 Products

Required fields are marked with *

My Review for All CCDC8 Products

Required fields are marked with *

0
cart-icon