Recombinant Human CCDC8 protein, GST-tagged
| Cat.No. : | CCDC8-301361H |
| Product Overview : | Recombinant Human CCDC8 (60-196 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Glu60-Glu196 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization |
| AA Sequence : | EKSTPHPPQPPKKPKEPRVRRRVQQMVTPPPRLVVGTYDSSNASDSEFSDFETSRDKSRQGPRRGKKVRKMPVSYLGSKFLGSDLESEDDEELVEAFLRRQEKQPSAPPARRRVNLPVPMFEDNLGPQLSKADRWRE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | CCDC8 coiled-coil domain containing 8 [ Homo sapiens ] |
| Official Symbol | CCDC8 |
| Synonyms | CCDC8; coiled-coil domain containing 8; coiled-coil domain-containing protein 8; 3M3; DKFZp564K0322; PPP1R20; protein phosphatase 1; regulatory subunit 20; protein phosphatase 1, regulatory subunit 20; p90; |
| Gene ID | 83987 |
| mRNA Refseq | NM_032040 |
| Protein Refseq | NP_114429 |
| MIM | 614145 |
| UniProt ID | Q9H0W5 |
| ◆ Recombinant Proteins | ||
| CCDC8-854R | Recombinant Rat CCDC8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CCDC8-1366M | Recombinant Mouse CCDC8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CCDC8-1196R | Recombinant Rat CCDC8 Protein | +Inquiry |
| CCDC8-2930M | Recombinant Mouse CCDC8 Protein | +Inquiry |
| CCDC8-301361H | Recombinant Human CCDC8 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCDC8-7747HCL | Recombinant Human CCDC8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC8 Products
Required fields are marked with *
My Review for All CCDC8 Products
Required fields are marked with *
