Recombinant Human CCDC8 protein, GST-tagged

• Cat.No.: CCDC8-301361H
• Product Overview: Recombinant Human CCDC8 (60-196 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Glu60-Glu196
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization
• AA Sequence: EKSTPHPPQPPKKPKEPRVRRRVQQMVTPPPRLVVGTYDSSNASDSEFSDFETSRDKSRQGPRRGKKVRKMPVSYLGSKFLGSDLESEDDEELVEAFLRRQEKQPSAPPARRRVNLPVPMFEDNLGPQLSKADRWRE
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: CCDC8 coiled-coil domain containing 8 [ Homo sapiens ]
• Official Symbol: CCDC8
• Synonyms: CCDC8; coiled-coil domain containing 8; coiled-coil domain-containing protein 8; 3M3; DKFZp564K0322; PPP1R20; protein phosphatase 1; regulatory subunit 20; protein phosphatase 1, regulatory subunit 20; p90
• Gene ID: 83987
• mRNA Refseq: NM_032040
• Protein Refseq: NP_114429
• MIM: 614145
• UniProt ID: Q9H0W5