Recombinant Human CCDC97 Protein, GST-Tagged
| Cat.No. : | CCDC97-0598H |
| Product Overview : | Human CCDC97 full-length ORF (NP_443080.1, 1 a.a. - 343 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CCDC97 (Coiled-Coil Domain Containing 97) is a Protein Coding gene. |
| Molecular Mass : | 65.3 kDa |
| AA Sequence : | MEAVATATAAKEPDKGCIEPGPGHWGELSRTPVPSKPQDKVEAAEATPVALDSDTSGAENAAVSAMLHAVAASRLPVCSQQQGEPDLTEHEKVAILAQLYHEKPLVFLERFRTGLREEHLACFGHVRGDHRADFYCAEVARQGTARPRTLRTRLRNRRYAALRELIQGGEYFSDEQMRFRAPLLYEQYIGQYLTQEELSARTPTHQPPKPGSPGRPACPLSNLLLQSYEERELQQRLLQQQEEEEACLEEEEEEEDSDEEDQRSGKDSEAWVPDSEERLILREEFTSRMHQRFLDGKDGDFDYSTVDDNPDFDNLDIVARDEEERYFDEEEPEDAPSPELDGD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCDC97 coiled-coil domain containing 97 [ Homo sapiens ] |
| Official Symbol | CCDC97 |
| Synonyms | CCDC97; coiled-coil domain containing 97 |
| Gene ID | 90324 |
| mRNA Refseq | NM_052848 |
| Protein Refseq | NP_443080 |
| UniProt ID | Q96F63 |
| ◆ Recombinant Proteins | ||
| CCDC97-5846H | Recombinant Human CCDC97 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CCDC97-2951M | Recombinant Mouse CCDC97 Protein | +Inquiry |
| CCDC97-2861H | Recombinant Human CCDC97 Protein, DDK-tagged | +Inquiry |
| CCDC97-1386M | Recombinant Mouse CCDC97 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ccdc97-2025M | Recombinant Mouse Ccdc97 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCDC97-7739HCL | Recombinant Human CCDC97 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC97 Products
Required fields are marked with *
My Review for All CCDC97 Products
Required fields are marked with *



