Recombinant Human CCDC97 Protein, GST-Tagged
Cat.No. : | CCDC97-0598H |
Product Overview : | Human CCDC97 full-length ORF (NP_443080.1, 1 a.a. - 343 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CCDC97 (Coiled-Coil Domain Containing 97) is a Protein Coding gene. |
Molecular Mass : | 65.3 kDa |
AA Sequence : | MEAVATATAAKEPDKGCIEPGPGHWGELSRTPVPSKPQDKVEAAEATPVALDSDTSGAENAAVSAMLHAVAASRLPVCSQQQGEPDLTEHEKVAILAQLYHEKPLVFLERFRTGLREEHLACFGHVRGDHRADFYCAEVARQGTARPRTLRTRLRNRRYAALRELIQGGEYFSDEQMRFRAPLLYEQYIGQYLTQEELSARTPTHQPPKPGSPGRPACPLSNLLLQSYEERELQQRLLQQQEEEEACLEEEEEEEDSDEEDQRSGKDSEAWVPDSEERLILREEFTSRMHQRFLDGKDGDFDYSTVDDNPDFDNLDIVARDEEERYFDEEEPEDAPSPELDGD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCDC97 coiled-coil domain containing 97 [ Homo sapiens ] |
Official Symbol | CCDC97 |
Synonyms | CCDC97; coiled-coil domain containing 97 |
Gene ID | 90324 |
mRNA Refseq | NM_052848 |
Protein Refseq | NP_443080 |
UniProt ID | Q96F63 |
◆ Recombinant Proteins | ||
CCDC97-1386M | Recombinant Mouse CCDC97 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC97-0598H | Recombinant Human CCDC97 Protein, GST-Tagged | +Inquiry |
CCDC97-2861H | Recombinant Human CCDC97 Protein, DDK-tagged | +Inquiry |
CCDC97-2951M | Recombinant Mouse CCDC97 Protein | +Inquiry |
Ccdc97-2025M | Recombinant Mouse Ccdc97 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC97-7739HCL | Recombinant Human CCDC97 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCDC97 Products
Required fields are marked with *
My Review for All CCDC97 Products
Required fields are marked with *
0
Inquiry Basket