Recombinant Human CCKBR protein

Cat.No. : CCKBR-25H
Product Overview : Recombinant Human CCKBR was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : This gene encodes a G-protein coupled receptor for gastrin and cholecystokinin (CCK), regulatory peptides of the brain and gastrointestinal tract. This protein is a type B gastrin receptor, which has a high affinity for both sulfated and nonsulfated CCKanalogs and is found principally in the central nervous system and the gastrointestinal tract. A misspliced transcript variant including an intron has been observed in cells from colorectal and pancreatic tumors.
Form : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass : 48.4 kDa
AA Sequence : MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLI IVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIAL ERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLL LFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRS RPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFI HLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG
Applications : Antibody Production;Functional Study: Recommended usage only, not validated yet.Compound Screening: Recommended usage only, not validated yet.
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name CCKBR cholecystokinin B receptor [ Homo sapiens ]
Official Symbol CCKBR
Synonyms CCKBR; cholecystokinin B receptor; gastrin/cholecystokinin type B receptor; CCK-BR; CCK2-R; CCK2 receptor; CCK-B receptor; gastrin receptor; cholecystokinin-2 receptor; GASR; CCK-B; CCK2R;
Gene ID 887
mRNA Refseq NM_176875
Protein Refseq NP_795344
MIM 118445
UniProt ID P32239
Chromosome Location 11p15.4
Pathway Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem;
Function 1-phosphatidylinositol-3-kinase regulator activity; G-protein coupled receptor activity; cholecystokinin receptor activity; gastrin receptor activity; phosphatidylinositol phospholipase C activity; receptor activity; signal transducer activity; type B gastrin/cholecystokinin receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCKBR Products

Required fields are marked with *

My Review for All CCKBR Products

Required fields are marked with *

0
cart-icon