Recombinant Human CCKBR protein CCKBR-25H

Recombinant Human CCKBR protein

PRODUCTS

Home / Products / Recombinant Human CCKBR protein

Recombinant Human CCKBR protein

CCKBR Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CCKBR-25H
Product Overview : Recombinant Human CCKBR was expressed in Wheat Germ.
Description : This gene encodes a G-protein coupled receptor for gastrin and cholecystokinin (CCK), regulatory peptides of the brain and gastrointestinal tract. This protein is a type B gastrin receptor, which has a high affinity for both sulfated and nonsulfated CCKanalogs and is found principally in the central nervous system and the gastrointestinal tract. A misspliced transcript variant including an intron has been observed in cells from colorectal and pancreatic tumors.
Source : Wheat Germ
Species : Human
Form : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass : 48.4 kDa
AA Sequence : MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLI IVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIAL ERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLL LFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRS RPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFI HLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG
Applications : Antibody Production;Functional Study: Recommended usage only, not validated yet.Compound Screening: Recommended usage only, not validated yet.
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : CCKBR cholecystokinin B receptor [ Homo sapiens ]
Official Symbol : CCKBR
Synonyms : CCKBR; cholecystokinin B receptor; gastrin/cholecystokinin type B receptor; CCK-BR; CCK2-R; CCK2 receptor; CCK-B receptor; gastrin receptor; cholecystokinin-2 receptor; GASR; CCK-B; CCK2R;
Gene ID : 887
mRNA Refseq : NM_176875
Protein Refseq : NP_795344
MIM : 118445
UniProt ID : P32239
Chromosome Location : 11p15.4
Pathway : Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem;
Function : 1-phosphatidylinositol-3-kinase regulator activity; G-protein coupled receptor activity; cholecystokinin receptor activity; gastrin receptor activity; phosphatidylinositol phospholipase C activity; receptor activity; signal transducer activity; type B gastrin/cholecystokinin receptor binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Back to School Promotion

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy