Recombinant Human CCL15 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CCL15-492H |
| Product Overview : | CCL15 MS Standard C13 and N15-labeled recombinant protein (NP_116740) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene is located in a cluster of similar genes in the same region of chromosome 17. These genes encode CC cytokines, which are secreted proteins characterized by two adjacent cysteines. The product of this gene is chemotactic for T cells and monocytes, and acts through C-C chemokine receptor type 1 (CCR1). The proprotein is further processed into numerous smaller functional peptides. Naturally-occurring readthrough transcripts occur from this gene into the downstream gene, CCL14 (chemokine (C-C motif) ligand 14). |
| Molecular Mass : | 12.7 kDa |
| AA Sequence : | MKVSVAALSCLMLVAVLGSQAQFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CCL15 C-C motif chemokine ligand 15 [ Homo sapiens (human) ] |
| Official Symbol | CCL15 |
| Synonyms | CCL15; chemokine (C-C motif) ligand 15; SCYA15, small inducible cytokine subfamily A (Cys Cys), member 15; C-C motif chemokine 15; CC chemokine 3; chemokine CC 2; HCC 2; HMRP 2B; leukotactin 1; Lkn 1; macrophage inflammatory protein 5; MIP 1 delta; MIP 1d; MIP 5; NCC 3; SCYL3; MIP-1 delta; chemokine CC-2; new CC chemokine 3; small-inducible cytokine A15; small inducible cytokine subfamily A (Cys-Cys), member 15; LKN1; NCC3; SY15; HCC-2; LKN-1; MIP-5; NCC-3; MIP-1D; MRP-2B; SCYA15; HMRP-2B; |
| Gene ID | 6359 |
| mRNA Refseq | NM_032964 |
| Protein Refseq | NP_116740 |
| MIM | 601393 |
| UniProt ID | Q16663 |
| ◆ Recombinant Proteins | ||
| CCL15-107H | Active Human CCL15 | +Inquiry |
| CCL15-3697H | Recombinant Human CCL15 protein, rFc-tagged | +Inquiry |
| CCL15-1174H | Recombinant Human CCL15 Protein (Ser46-Ile113), N-GST tagged | +Inquiry |
| CCL15-82H | Recombinant Human CCL15 Protein, Biotin-tagged | +Inquiry |
| CCL15-0611H | Recombinant Human CCL15 Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCL15-7731HCL | Recombinant Human CCL15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL15 Products
Required fields are marked with *
My Review for All CCL15 Products
Required fields are marked with *




