Recombinant Human CCL3L1 protein
Cat.No. : | CCL3L1-606H |
Product Overview : | Recombinant Human CCL3L1 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 70 |
Description : | CCL3L1, also named LD78-beta, is belonging to the intercrine beta (chemokine CC) family and it is encoded by the CCL3L1 gene in humans. This protein binds to several chemokine receptors including chemokine binding protein 2 (CCBP2 or D6) and chemokine (C-C motif) receptor 5 (CCR5). It is an inhibitor of HIV-1-infection and chemotactic for lymphocytes and monocytes. Recombinant human LD78β is a 7.7 kDa protein containing 70 amino acid residues, including the four conserved cysteine residues present in CC chemokines. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 1.0-10 ng/ml. |
Molecular Mass : | Approximately 7.8 kDa protein containing 70 amino acid residues, including the four highly conserved cysteine residues present in CC chemokines. |
AA Sequence : | APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA |
Endotoxin : | Less than 1 EU/μg of rHuLD78-β/CCL3L1 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CCL3L1 |
Official Symbol | CCL3L1 |
Synonyms | CCL3L1; chemokine (C-C motif) ligand 3-like 1; D17S1718, SCYA3L, SCYA3L1, small inducible cytokine A3 like 1; C-C motif chemokine 3-like 1; G0S19 2; LD78BETA; PAT 464.2; LD78-beta(1-70); small inducible cytokine A3-like 1; small-inducible cytokine A3-like 1; G0/G1 switch regulatory protein 19-2; tonsillar lymphocyte LD78 beta protein; LD78; 464.2; MIP1AP; SCYA3L; G0S19-2; SCYA3L1; D17S1718; MGC12815; MGC104178; MGC182017; |
Gene ID | 6349 |
mRNA Refseq | NM_021006 |
Protein Refseq | NP_066286 |
MIM | 601395 |
UniProt ID | P16619 |
◆ Recombinant Proteins | ||
CCL3L1-1082H | Recombinant Human CCL3L1 Protein (Ala24-Ala93), C-His tagged | +Inquiry |
CCL3L1-597H | Recombinant Human CCL3L1 protein, His & GST-tagged | +Inquiry |
CCL3L1-0639H | Recombinant Human CCL3L1 Protein, GST-Tagged | +Inquiry |
CCL3L1-68H | Recombinant Human CCL3L1 | +Inquiry |
CCL3L1-145S | Recombinant Swine Chemokine (C-C motif) Ligand 3-like 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL3L1-7722HCL | Recombinant Human CCL3L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL3L1 Products
Required fields are marked with *
My Review for All CCL3L1 Products
Required fields are marked with *
0
Inquiry Basket