Recombinant Human CCL3L1 protein

Cat.No. : CCL3L1-606H
Product Overview : Recombinant Human CCL3L1 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 70
Description : CCL3L1, also named LD78-beta, is belonging to the intercrine beta (chemokine CC) family and it is encoded by the CCL3L1 gene in humans. This protein binds to several chemokine receptors including chemokine binding protein 2 (CCBP2 or D6) and chemokine (C-C motif) receptor 5 (CCR5). It is an inhibitor of HIV-1-infection and chemotactic for lymphocytes and monocytes. Recombinant human LD78β is a 7.7 kDa protein containing 70 amino acid residues, including the four conserved cysteine residues present in CC chemokines.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 1.0-10 ng/ml.
Molecular Mass : Approximately 7.8 kDa protein containing 70 amino acid residues, including the four highly conserved cysteine residues present in CC chemokines.
AA Sequence : APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
Endotoxin : Less than 1 EU/μg of rHuLD78-β/CCL3L1 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name CCL3L1
Official Symbol CCL3L1
Synonyms CCL3L1; chemokine (C-C motif) ligand 3-like 1; D17S1718, SCYA3L, SCYA3L1, small inducible cytokine A3 like 1; C-C motif chemokine 3-like 1; G0S19 2; LD78BETA; PAT 464.2; LD78-beta(1-70); small inducible cytokine A3-like 1; small-inducible cytokine A3-like 1; G0/G1 switch regulatory protein 19-2; tonsillar lymphocyte LD78 beta protein; LD78; 464.2; MIP1AP; SCYA3L; G0S19-2; SCYA3L1; D17S1718; MGC12815; MGC104178; MGC182017;
Gene ID 6349
mRNA Refseq NM_021006
Protein Refseq NP_066286
MIM 601395
UniProt ID P16619

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL3L1 Products

Required fields are marked with *

My Review for All CCL3L1 Products

Required fields are marked with *

0
cart-icon