Recombinant Human CCN5 Protein
Cat.No. : | CCN5-37H |
Product Overview : | Recombinant Human CCN5 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | WNT1-inducible-signaling pathway protein 2 (WISP-2) is a member of the CYR61/CTGF/NOV (CCN) family of regulatory factors. WISP-2 is expressed in ectodermal, mesodermal, and endodermal lineages, including primary osteoblasts, fibroblasts, mesenchymal stem cells, and adipogenic precursor cells. WISP-2 is a canonical WNT ligand that regulates cell proliferation, adhesion, and metastasis. Secreted WISP-2 promotes mesenchymal precursor cell proliferation and maintains them in an undifferentiated state. In bone-forming osteoblasts, WISP-2 promotes osteoblast adhesion and inhibits osteocalcin production. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 24.4 kDa (228 aa) |
AA Sequence : | MQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile 10 mM acetic acid at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | CCN5 cellular communication network factor 5 [ Homo sapiens (human) ] |
Official Symbol | CCN5 |
Synonyms | CCN5; cellular communication network factor 5; CT58; WISP2; CTGF-L; CCN family member 5; WNT1 inducible signaling pathway protein 2; connective tissue growth factor-like protein; connective tissue growth factor-related protein 58 |
Gene ID | 8839 |
mRNA Refseq | NM_003881 |
Protein Refseq | NP_003872 |
MIM | www.omim.org/entry/603399 |
UniProt ID | O76076 |
◆ Recombinant Proteins | ||
CCN5-523H | Recombinant Human CCN5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCN5-776HFL | Recombinant Full Length Human CCN5 Protein, C-Flag-tagged | +Inquiry |
CCN5-37H | Recombinant Human CCN5 Protein | +Inquiry |
Ccn5-2047M | Recombinant Mouse Ccn5 Protein, Myc/DDK-tagged | +Inquiry |
CCN5-2728H | Recombinant Human CCN5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCN5 Products
Required fields are marked with *
My Review for All CCN5 Products
Required fields are marked with *