Recombinant Human CCNB1 Protein (1-433 aa), His-tagged
Cat.No. : | CCNB1-2225H |
Product Overview : | Recombinant Human CCNB1 Protein (1-433 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-433 aa |
Description : | Essential for the control of the cell cycle at the G2/M (mitosis) transition. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 50.3 kDa |
AA Sequence : | MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | CCNB1 cyclin B1 [ Homo sapiens ] |
Official Symbol | CCNB1 |
Synonyms | CCNB1; cyclin B1; CCNB; G2/mitotic-specific cyclin-B1; G2/mitotic specific cyclin B1; |
Gene ID | 891 |
mRNA Refseq | NM_031966 |
Protein Refseq | NP_114172 |
MIM | 123836 |
UniProt ID | P14635 |
◆ Recombinant Proteins | ||
CCNB1-2654H | Recombinant Human CCNB1 protein(11-110 aa), N-MBP & C-His-tagged | +Inquiry |
CCNB1-9062Z | Recombinant Zebrafish CCNB1 | +Inquiry |
CCNB1-2983M | Recombinant Mouse Ccnb1 Protein, His-tagged | +Inquiry |
CCNB1-2959HF | Recombinant Full Length Human CCNB1 Protein, GST-tagged | +Inquiry |
CCNB1-1529H | Recombinant Human Cyclin B1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNB1-303HCL | Recombinant Human CCNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNB1 Products
Required fields are marked with *
My Review for All CCNB1 Products
Required fields are marked with *