Recombinant Human CCNB1 protein(11-110 aa), N-MBP & C-His-tagged
Cat.No. : | CCNB1-2654H |
Product Overview : | Recombinant Human CCNB1 protein(P14635)(11-110 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&MBP |
Protein Length : | 11-110 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | INAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPV |
Gene Name | CCNB1 cyclin B1 [ Homo sapiens ] |
Official Symbol | CCNB1 |
Synonyms | CCNB1; cyclin B1; CCNB; G2/mitotic-specific cyclin-B1; G2/mitotic specific cyclin B1; G2/mitotic-specific cyclin B1; |
Gene ID | 891 |
mRNA Refseq | NM_031966 |
Protein Refseq | NP_114172 |
MIM | 123836 |
UniProt ID | P14635 |
◆ Recombinant Proteins | ||
CCNB1-9062Z | Recombinant Zebrafish CCNB1 | +Inquiry |
CCNB1-1218R | Recombinant Rat CCNB1 Protein | +Inquiry |
CCNB1-0894H | Recombinant Human CCNB1 Protein (Met1-Pro91), N-His tagged | +Inquiry |
CCNB1-525R | Recombinant Rhesus Macaque CCNB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCNB1-2653H | Recombinant Human CCNB1 protein(101-220 aa), N-MBP & C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNB1-303HCL | Recombinant Human CCNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCNB1 Products
Required fields are marked with *
My Review for All CCNB1 Products
Required fields are marked with *
0
Inquiry Basket