Recombinant Human CCNB1 protein, His&Myc-tagged
Cat.No. : | CCNB1-2206H |
Product Overview : | Recombinant Human CCNB1 protein(P14635)(1-433aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 1-433aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 52.3 kDa |
AA Sequence : | MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CCNB1 cyclin B1 [ Homo sapiens ] |
Official Symbol | CCNB1 |
Synonyms | CCNB1; cyclin B1; CCNB; G2/mitotic-specific cyclin-B1; G2/mitotic specific cyclin B1; G2/mitotic-specific cyclin B1; |
Gene ID | 891 |
mRNA Refseq | NM_031966 |
Protein Refseq | NP_114172 |
MIM | 123836 |
UniProt ID | P14635 |
◆ Recombinant Proteins | ||
CCNB1-2983M | Recombinant Mouse Ccnb1 Protein, His-tagged | +Inquiry |
CCNB1-27519TH | Recombinant Human CCNB1, His-tagged | +Inquiry |
CCNB1-0650H | Recombinant Human CCNB1 Protein, GST-Tagged | +Inquiry |
CCNB1-876R | Recombinant Rat CCNB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCNB1-6853H | Recombinant Human Cyclin B1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNB1-303HCL | Recombinant Human CCNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNB1 Products
Required fields are marked with *
My Review for All CCNB1 Products
Required fields are marked with *