Recombinant Human CCND3 Protein, His/Avi tagged, Biotinylated

Cat.No. : CCND3-001HB
Product Overview : Biotinylated Recombinant Human CCND3 Protein with His/Avi tag was expressed in HEK293.
Availability October 11, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Avi&His
Description : The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activtiy is required for cell cycle G1/S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. The CDK4 activity associated with this cyclin was reported to be necessary for cell cycle progression through G2 phase into mitosis after UV radiation. Several transcript variants encoding different isoforms have been found for this gene.
Form : Liquid
Molecular Mass : The protein has a calculated MW of 36 kDa.
AA Sequence : MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHLHHHHHHHHGLNDIFEAQKIEWHE
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.67 mg/mL
Storage Buffer : Liquid in sterile PBS, pH 7.4, 10% Glycerol
Conjugation : Biotin
Gene Name CCND3 cyclin D3 [ Homo sapiens ]
Official Symbol CCND3
Synonyms CCND3; cyclin D3; G1/S-specific cyclin-D3; D3-type cyclin; G1/S-specific cyclin D3;
Gene ID 896
mRNA Refseq NM_001136017
Protein Refseq NP_001129489
MIM 123834
UniProt ID P30281

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCND3 Products

Required fields are marked with *

My Review for All CCND3 Products

Required fields are marked with *

0
cart-icon
0
compare icon