Recombinant Human CCND3 Protein, His/Avi tagged, Biotinylated
Cat.No. : | CCND3-001HB |
Product Overview : | Biotinylated Recombinant Human CCND3 Protein with His/Avi tag was expressed in HEK293. |
Availability | June 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Avi&His |
Description : | The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activtiy is required for cell cycle G1/S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. The CDK4 activity associated with this cyclin was reported to be necessary for cell cycle progression through G2 phase into mitosis after UV radiation. Several transcript variants encoding different isoforms have been found for this gene. |
Form : | Liquid |
Molecular Mass : | The protein has a calculated MW of 36 kDa. |
AA Sequence : | MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHLHHHHHHHHGLNDIFEAQKIEWHE |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.67 mg/mL |
Storage Buffer : | Liquid in sterile PBS, pH 7.4, 10% Glycerol |
Gene Name | CCND3 cyclin D3 [ Homo sapiens ] |
Official Symbol | CCND3 |
Synonyms | CCND3; cyclin D3; G1/S-specific cyclin-D3; D3-type cyclin; G1/S-specific cyclin D3; |
Gene ID | 896 |
mRNA Refseq | NM_001136017 |
Protein Refseq | NP_001129489 |
MIM | 123834 |
UniProt ID | P30281 |
◆ Recombinant Proteins | ||
CCND3-879R | Recombinant Rat CCND3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCND3-1831C | Recombinant Chicken CCND3 | +Inquiry |
CCND3-31765TH | Recombinant Human Human CDK6, His-tagged | +Inquiry |
CCND3-2532H | Recombinant Human CCND3 protein, His-tagged | +Inquiry |
CCND3-527R | Recombinant Rhesus Macaque CCND3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCND3-305HCL | Recombinant Human CCND3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCND3 Products
Required fields are marked with *
My Review for All CCND3 Products
Required fields are marked with *
0
Inquiry Basket