Recombinant Human CCNG1 protein, GST-tagged
Cat.No. : | CCNG1-3613H |
Product Overview : | Recombinant Human CCNG1 protein(1-46 aa), fused to GST tag, was expressed in E. coli. |
Availability | August 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-46 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MIEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLR |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CCNG1 cyclin G1 [ Homo sapiens ] |
Official Symbol | CCNG1 |
Synonyms | CCNG1; cyclin G1; CCNG; cyclin-G1; cyclin-G; |
Gene ID | 900 |
mRNA Refseq | NM_004060 |
Protein Refseq | NP_004051 |
MIM | 601578 |
UniProt ID | P51959 |
◆ Recombinant Proteins | ||
CCNG1-9922Z | Recombinant Zebrafish CCNG1 | +Inquiry |
CCNG1-2995M | Recombinant Mouse CCNG1 Protein | +Inquiry |
CCNG1-1408M | Recombinant Mouse CCNG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCNG1-882R | Recombinant Rat CCNG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCNG1-26094TH | Recombinant Human CCNG1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNG1-7707HCL | Recombinant Human CCNG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNG1 Products
Required fields are marked with *
My Review for All CCNG1 Products
Required fields are marked with *