Recombinant Human CCNI protein, His-tagged
Cat.No. : | CCNI-3978H |
Product Overview : | Recombinant Human CCNI protein(259-377 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 259-377 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VYVYRPLKHTLVTCDKGVFRLHPSSVPGPDFSKDNSKPEVPVRGTAAFYHHLPAASGCKQTSTKRKVEEMEVDDFYDGIKRLYNEDNVSENVGSVCGTDLSRQEGHASPCPPLQPVSVM |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CCNI cyclin I [ Homo sapiens ] |
Official Symbol | CCNI |
Synonyms | CCNI; cyclin I; cyclin-I; cyclin ITI; CYI; CYC1; |
Gene ID | 10983 |
mRNA Refseq | NM_006835 |
Protein Refseq | NP_006826 |
UniProt ID | Q14094 |
◆ Recombinant Proteins | ||
CCNI-0674H | Recombinant Human CCNI Protein, GST-Tagged | +Inquiry |
CCNI-12424Z | Recombinant Zebrafish CCNI | +Inquiry |
CCNI-10869H | Recombinant Human CCNI, GST-tagged | +Inquiry |
CCNI-530R | Recombinant Rhesus Macaque CCNI Protein, His (Fc)-Avi-tagged | +Inquiry |
Ccni-800M | Recombinant Mouse Ccni Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNI-7704HCL | Recombinant Human CCNI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCNI Products
Required fields are marked with *
My Review for All CCNI Products
Required fields are marked with *
0
Inquiry Basket