Recombinant Human CCNI protein, His-tagged
| Cat.No. : | CCNI-3978H |
| Product Overview : | Recombinant Human CCNI protein(259-377 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | February 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 259-377 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | VYVYRPLKHTLVTCDKGVFRLHPSSVPGPDFSKDNSKPEVPVRGTAAFYHHLPAASGCKQTSTKRKVEEMEVDDFYDGIKRLYNEDNVSENVGSVCGTDLSRQEGHASPCPPLQPVSVM |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CCNI cyclin I [ Homo sapiens ] |
| Official Symbol | CCNI |
| Synonyms | CCNI; cyclin I; cyclin-I; cyclin ITI; CYI; CYC1; |
| Gene ID | 10983 |
| mRNA Refseq | NM_006835 |
| Protein Refseq | NP_006826 |
| UniProt ID | Q14094 |
| ◆ Recombinant Proteins | ||
| CCNI-2977HF | Recombinant Full Length Human CCNI Protein, GST-tagged | +Inquiry |
| CCNI-0674H | Recombinant Human CCNI Protein, GST-Tagged | +Inquiry |
| CCNI-10869H | Recombinant Human CCNI, GST-tagged | +Inquiry |
| CCNI-12424Z | Recombinant Zebrafish CCNI | +Inquiry |
| CCNI-3978H | Recombinant Human CCNI protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCNI-7704HCL | Recombinant Human CCNI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNI Products
Required fields are marked with *
My Review for All CCNI Products
Required fields are marked with *
