Recombinant Human CCNYL1 protein, GST-tagged
| Cat.No. : | CCNYL1-301397H |
| Product Overview : | Recombinant Human CCNYL1 protein(1-62 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-62 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.0). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AASequence : | MPEDLALESNPSDHPRASTIFLSKSQTDVREKRKSNHLNHCDLSNILPHKEQREKVPEEYFK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CCNYL1 cyclin Y-like 1 [ Homo sapiens ] |
| Official Symbol | CCNYL1 |
| Synonyms | CCNYL1; cyclin Y-like 1; cyclin-Y-like protein 1; FLJ40432; |
| Gene ID | 151195 |
| mRNA Refseq | NM_001142300 |
| Protein Refseq | NP_001135772 |
| UniProt ID | Q8N7R7 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNYL1 Products
Required fields are marked with *
My Review for All CCNYL1 Products
Required fields are marked with *
