Recombinant Human CCNYL1 protein, GST-tagged
Cat.No. : | CCNYL1-301397H |
Product Overview : | Recombinant Human CCNYL1 (1-62 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Lys62 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MPEDLALESNPSDHPRASTIFLSKSQTDVREKRKSNHLNHCDLSNILPHKEQREKVPEEYFK |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | CCNYL1 cyclin Y-like 1 [ Homo sapiens ] |
Official Symbol | CCNYL1 |
Synonyms | CCNYL1; cyclin Y-like 1; cyclin-Y-like protein 1; FLJ40432; |
Gene ID | 151195 |
mRNA Refseq | NM_001142300 |
Protein Refseq | NP_001135772 |
UniProt ID | Q8N7R7 |
◆ Recombinant Proteins | ||
CCNYL1-3046H | Recombinant Human CCNYL1 Protein, His-tagged | +Inquiry |
CCNYL1-301397H | Recombinant Human CCNYL1 protein, GST-tagged | +Inquiry |
CCNYL1-2995HF | Recombinant Full Length Human CCNYL1 Protein, GST-tagged | +Inquiry |
CCNYL1-0683H | Recombinant Human CCNYL1 Protein, GST-Tagged | +Inquiry |
CCNYL1-4562Z | Recombinant Zebrafish CCNYL1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNYL1-7699HCL | Recombinant Human CCNYL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNYL1 Products
Required fields are marked with *
My Review for All CCNYL1 Products
Required fields are marked with *