Recombinant Human CCS, His-tagged
Cat.No. : | CCS-31477TH |
Product Overview : | Recombinant full length Human Superoxide Dismutase 4 with an N terminal His tag; 294 amino acids with a predicted MWt 31.2kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 274 amino acids |
Description : | Copper chaperone for superoxide dismutase specifically delivers Cu to copper/zinc superoxide dismutase and may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor. |
Conjugation : | HIS |
Molecular Weight : | 31.200kDa inclusive of tags |
Tissue specificity : | Ubiquitous. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL |
Sequence Similarities : | In the C-terminal section; belongs to the Cu-Zn superoxide dismutase family.Contains 1 HMA domain. |
Gene Name | CCS copper chaperone for superoxide dismutase [ Homo sapiens ] |
Official Symbol | CCS |
Synonyms | CCS; copper chaperone for superoxide dismutase; |
Gene ID | 9973 |
mRNA Refseq | NM_005125 |
Protein Refseq | NP_005116 |
MIM | 603864 |
Uniprot ID | O14618 |
Chromosome Location | 11 |
Pathway | Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; |
Function | copper ion binding; copper ion transmembrane transporter activity; metal ion binding; protein binding; NOT superoxide dismutase activity; |
◆ Recombinant Proteins | ||
CCS-10894H | Recombinant Human CCS, GST-tagged | +Inquiry |
CCS-711R | Recombinant Rhesus monkey CCS Protein, His-tagged | +Inquiry |
CCS-189H | Recombinant Human CCS protein | +Inquiry |
CCS-3038HF | Recombinant Full Length Human CCS Protein, GST-tagged | +Inquiry |
CCS-31478TH | Recombinant Human CCS | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCS-312HCL | Recombinant Human CCS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCS Products
Required fields are marked with *
My Review for All CCS Products
Required fields are marked with *