Recombinant Human CCS, His-tagged

• Cat.No.: CCS-31477TH
• Product Overview: Recombinant full length Human Superoxide Dismutase 4 with an N terminal His tag; 294 amino acids with a predicted MWt 31.2kDa including tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 274 amino acids
• Description: Copper chaperone for superoxide dismutase specifically delivers Cu to copper/zinc superoxide dismutase and may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor.
• Conjugation: HIS
• Molecular Weight: 31.200kDa inclusive of tags
• Tissue specificity: Ubiquitous.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL
• Sequence Similarities: In the C-terminal section; belongs to the Cu-Zn superoxide dismutase family.Contains 1 HMA domain.

Gene Information

• Gene Name: CCS copper chaperone for superoxide dismutase [ Homo sapiens ]
• Official Symbol: CCS
• Synonyms: CCS; copper chaperone for superoxide dismutase
• Gene ID: 9973
• mRNA Refseq: NM_005125
• Protein Refseq: NP_005116
• MIM: 603864
• Uniprot ID: O14618
• Chromosome Location: 11
• Pathway: Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem
• Function: copper ion binding; copper ion transmembrane transporter activity; metal ion binding; protein binding; NOT superoxide dismutase activity