Recombinant Human CCS, His-tagged
| Cat.No. : | CCS-31477TH |
| Product Overview : | Recombinant full length Human Superoxide Dismutase 4 with an N terminal His tag; 294 amino acids with a predicted MWt 31.2kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 274 amino acids |
| Description : | Copper chaperone for superoxide dismutase specifically delivers Cu to copper/zinc superoxide dismutase and may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor. |
| Conjugation : | HIS |
| Molecular Weight : | 31.200kDa inclusive of tags |
| Tissue specificity : | Ubiquitous. |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL |
| Sequence Similarities : | In the C-terminal section; belongs to the Cu-Zn superoxide dismutase family.Contains 1 HMA domain. |
| Gene Name | CCS copper chaperone for superoxide dismutase [ Homo sapiens ] |
| Official Symbol | CCS |
| Synonyms | CCS; copper chaperone for superoxide dismutase; |
| Gene ID | 9973 |
| mRNA Refseq | NM_005125 |
| Protein Refseq | NP_005116 |
| MIM | 603864 |
| Uniprot ID | O14618 |
| Chromosome Location | 11 |
| Pathway | Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; |
| Function | copper ion binding; copper ion transmembrane transporter activity; metal ion binding; protein binding; NOT superoxide dismutase activity; |
| ◆ Recombinant Proteins | ||
| CCS-8011Z | Recombinant Zebrafish CCS | +Inquiry |
| CCS-538R | Recombinant Rhesus Macaque CCS Protein, His (Fc)-Avi-tagged | +Inquiry |
| CCS-711R | Recombinant Rhesus monkey CCS Protein, His-tagged | +Inquiry |
| Ccs-2632R | Recombinant Rat Ccs protein, His & T7-tagged | +Inquiry |
| CCS-888R | Recombinant Rat CCS Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCS-312HCL | Recombinant Human CCS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCS Products
Required fields are marked with *
My Review for All CCS Products
Required fields are marked with *
