Recombinant Human CCS, His-tagged

Cat.No. : CCS-31477TH
Product Overview : Recombinant full length Human Superoxide Dismutase 4 with an N terminal His tag; 294 amino acids with a predicted MWt 31.2kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 274 amino acids
Description : Copper chaperone for superoxide dismutase specifically delivers Cu to copper/zinc superoxide dismutase and may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor.
Conjugation : HIS
Molecular Weight : 31.200kDa inclusive of tags
Tissue specificity : Ubiquitous.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL
Sequence Similarities : In the C-terminal section; belongs to the Cu-Zn superoxide dismutase family.Contains 1 HMA domain.
Gene Name CCS copper chaperone for superoxide dismutase [ Homo sapiens ]
Official Symbol CCS
Synonyms CCS; copper chaperone for superoxide dismutase;
Gene ID 9973
mRNA Refseq NM_005125
Protein Refseq NP_005116
MIM 603864
Uniprot ID O14618
Chromosome Location 11
Pathway Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem;
Function copper ion binding; copper ion transmembrane transporter activity; metal ion binding; protein binding; NOT superoxide dismutase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCS Products

Required fields are marked with *

My Review for All CCS Products

Required fields are marked with *

0
cart-icon