Recombinant Human CD109 Protein, C-His-tagged

Cat.No. : CD109-018H
Product Overview : Recombinant Human CD109 Protein with C-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : CD109 is a glycosylphosphatidylinositol (GPI)-linked glycoprotein that belongs to the alpha2-macroglobulin family of thioester containing proteins. CD109 is associated with TGF-beta receptor I (TbRI) and inhibits TGF-beta signaling. Cleavage of CD109 at its Furin cleavage site results in the release of its large amino-terminal domain, which then binds to the TGF-beta receptor I to inhibit TGF-beta signaling. CD109 is expressed on a subset of CD34+ bone marrow cells and mesenchymal stem cells, activated platelets, activated T cells, endothelial cells, and a wide variety of tumors. Elevated CD109 expression has been considered a diagnostic/prognostic marker for several types of cancers.
Molecular Mass : ~36 kDa
AA Sequence : LSSVGSPKAKEALNMLTWRAEQEGGMQFWVSSESKLSDSWQPRSLDIEVAAYALLSHFLQFQTSEGIPIMRWLSRQRNSLGGFASTQDTTVALKALSEFAALMNTERTNIQVTVTGPSSPSPVKFLIDTHNRLLLQTAELAVVQPTAVNISANGFGFAICQLNVVYNVKASGSSRRRRSIQNQEAFDLDVAVKENKDDLNHVDLNVCTSFSGPGRSGMALMEVNLLSGFMVPSEAISLSETVKKVEYDHGKLNLYLDSVNETQFCVNIPAVRNFKVSNTQDASVSIVDYYEPRRQAVRSYNSEVKLSSCDLCSDVQGCRPCEDGA
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name CD109 CD109 molecule [ Homo sapiens (human) ]
Official Symbol CD109
Synonyms CD109; CD109 molecule; CD109 antigen (Gov platelet alloantigens); CD109 antigen; CPAMD7; DKFZp762L1111; FLJ38569; p180; r150; Gov platelet alloantigens; activated T-cell marker CD109; platelet-specific Gov antigen; 150 kDa TGF-beta-1-binding protein; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 7; RP11-525G3.1; FLJ41966;
Gene ID 135228
mRNA Refseq NM_001159587
Protein Refseq NP_001153059
MIM 608859
UniProt ID Q6YHK3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD109 Products

Required fields are marked with *

My Review for All CD109 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon