Recombinant Human CD109 Protein, C-His-tagged
Cat.No. : | CD109-018H |
Product Overview : | Recombinant Human CD109 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | CD109 is a glycosylphosphatidylinositol (GPI)-linked glycoprotein that belongs to the alpha2-macroglobulin family of thioester containing proteins. CD109 is associated with TGF-beta receptor I (TbRI) and inhibits TGF-beta signaling. Cleavage of CD109 at its Furin cleavage site results in the release of its large amino-terminal domain, which then binds to the TGF-beta receptor I to inhibit TGF-beta signaling. CD109 is expressed on a subset of CD34+ bone marrow cells and mesenchymal stem cells, activated platelets, activated T cells, endothelial cells, and a wide variety of tumors. Elevated CD109 expression has been considered a diagnostic/prognostic marker for several types of cancers. |
Molecular Mass : | ~36 kDa |
AA Sequence : | LSSVGSPKAKEALNMLTWRAEQEGGMQFWVSSESKLSDSWQPRSLDIEVAAYALLSHFLQFQTSEGIPIMRWLSRQRNSLGGFASTQDTTVALKALSEFAALMNTERTNIQVTVTGPSSPSPVKFLIDTHNRLLLQTAELAVVQPTAVNISANGFGFAICQLNVVYNVKASGSSRRRRSIQNQEAFDLDVAVKENKDDLNHVDLNVCTSFSGPGRSGMALMEVNLLSGFMVPSEAISLSETVKKVEYDHGKLNLYLDSVNETQFCVNIPAVRNFKVSNTQDASVSIVDYYEPRRQAVRSYNSEVKLSSCDLCSDVQGCRPCEDGA |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD109 CD109 molecule [ Homo sapiens (human) ] |
Official Symbol | CD109 |
Synonyms | CD109; CD109 molecule; CD109 antigen (Gov platelet alloantigens); CD109 antigen; CPAMD7; DKFZp762L1111; FLJ38569; p180; r150; Gov platelet alloantigens; activated T-cell marker CD109; platelet-specific Gov antigen; 150 kDa TGF-beta-1-binding protein; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 7; RP11-525G3.1; FLJ41966; |
Gene ID | 135228 |
mRNA Refseq | NM_001159587 |
Protein Refseq | NP_001153059 |
MIM | 608859 |
UniProt ID | Q6YHK3 |
◆ Recombinant Proteins | ||
CD109-108H | Active Recombinant Human CD109, His-tagged | +Inquiry |
CD109-0667H | Recombinant Human CD109 Protein (22-1268), His tagged | +Inquiry |
CD109-2981H | Recombinant Human CD109 protein, His-Avi-tagged, Biotinylated | +Inquiry |
CD109-018H | Recombinant Human CD109 Protein, C-His-tagged | +Inquiry |
Cd109-6985M | Recombinant Mouse Cd109 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD109-314HCL | Recombinant Human CD109 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD109 Products
Required fields are marked with *
My Review for All CD109 Products
Required fields are marked with *
0
Inquiry Basket