Recombinant Human CD151 Protein

• Cat.No.: CD151-0722H
• Product Overview: Human CD151 full-length ORF (NP_004348.2) recombinant protein without tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Description: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. This protein enhances cell motility, invasion and metastasis of cancer cells. Multiple alternatively spliced transcript variants that encode the same protein have been described for this gene. [provided by RefSeq, Jul 2008]
• Form: Liquid
• Molecular Mass: 28.3 kDa
• AA Sequence: MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: CD151 CD151 molecule (Raph blood group) [ Homo sapiens ]
• Official Symbol: CD151
• Synonyms: CD151; CD151 molecule (Raph blood group); CD151 antigen, CD151 antigen (Raph blood group); CD151 antigen; PETA 3; RAPH; SFA 1; TSPAN24; tspan-24; tetraspanin-24; membrane glycoprotein SFA-1; CD151 antigen (Raph blood group); hemidesmosomal tetraspanin CD151; platelet surface glycoprotein gp27; platelet-endothelial tetraspan antigen 3; platelet-endothelial cell tetraspan antigen 3; GP27; MER2; SFA1; PETA-3
• Gene ID: 977
• mRNA Refseq: NM_001039490
• Protein Refseq: NP_001034579
• MIM: 602243
• UniProt ID: P48509