Recombinant Human CD151 Protein
| Cat.No. : | CD151-0722H |
| Product Overview : | Human CD151 full-length ORF (NP_004348.2) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. This protein enhances cell motility, invasion and metastasis of cancer cells. Multiple alternatively spliced transcript variants that encode the same protein have been described for this gene. [provided by RefSeq, Jul 2008] |
| Form : | Liquid |
| Molecular Mass : | 28.3 kDa |
| AA Sequence : | MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY |
| Applications : | Antibody Production Functional Study Compound Screening |
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | CD151 CD151 molecule (Raph blood group) [ Homo sapiens ] |
| Official Symbol | CD151 |
| Synonyms | CD151; CD151 molecule (Raph blood group); CD151 antigen, CD151 antigen (Raph blood group); CD151 antigen; PETA 3; RAPH; SFA 1; TSPAN24; tspan-24; tetraspanin-24; membrane glycoprotein SFA-1; CD151 antigen (Raph blood group); hemidesmosomal tetraspanin CD151; platelet surface glycoprotein gp27; platelet-endothelial tetraspan antigen 3; platelet-endothelial cell tetraspan antigen 3; GP27; MER2; SFA1; PETA-3; |
| Gene ID | 977 |
| mRNA Refseq | NM_001039490 |
| Protein Refseq | NP_001034579 |
| MIM | 602243 |
| UniProt ID | P48509 |
| ◆ Recombinant Proteins | ||
| CD151-3035M | Recombinant Mouse CD151 Protein | +Inquiry |
| CD151-1587R | Recombinant Rhesus Monkey CD151 Protein, hIgG4-tagged | +Inquiry |
| CD151-894R | Recombinant Rat CD151 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CD151-1434M | Recombinant Mouse CD151 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL11726MF | Recombinant Full Length Macaca Mulatta (Rhesus Macaque) Cd151 Antigen(Cd151) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD151-7684HCL | Recombinant Human CD151 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD151 Products
Required fields are marked with *
My Review for All CD151 Products
Required fields are marked with *
