Recombinant Human CD151 Protein, C-His-tagged

Cat.No. : CD151-211H
Product Overview : Recombinant Human CD151 Protein with C-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : CD151 (PETA-3, SFA-1) is a member of the evolutionarily conserved tetraspanin family of multipass glycoproteins (TM4SF), highlighted by four transmembrane domains, two extracellular loops, and N/C-termini that reside within the cytoplasm. Identified as the first member of the tetraspanin family to be implicated in tumorigenesis, research studies have demonstrated that CD151 participates in tumor neovascularization, tumor cell cell invasion, and cell adhesion. Furthermore, a positive correlation exists between CD151 expression levels and poor prognosis for tumors of the lung, kidney, and prostate. CD151 is localized predominantly to the plasma membrane and research studies have demonstrated that CD151 exerts its pro-tumorigenic effects, in part, through the modulation of laminin-binding integrins and oncogenic receptor tyrosine kinases, such as c-Met and EGFR.
Molecular Mass : ~12 kDa
AA Sequence : AYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name CD151 CD151 molecule (Raph blood group) [ Homo sapiens (human) ]
Official Symbol CD151
Synonyms CD151; CD151 molecule (Raph blood group); CD151 antigen , CD151 antigen (Raph blood group); CD151 antigen; PETA 3; RAPH; SFA 1; TSPAN24; tspan-24; tetraspanin-24; membrane glycoprotein SFA-1; CD151 antigen (Raph blood group); hemidesmosomal tetraspanin CD151; platelet surface glycoprotein gp27; platelet-endothelial tetraspan antigen 3; platelet-endothelial cell tetraspan antigen 3; GP27; MER2; SFA1; PETA-3;
Gene ID 977
mRNA Refseq NM_001039490
Protein Refseq NP_001034579
MIM 602243
UniProt ID P48509

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD151 Products

Required fields are marked with *

My Review for All CD151 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon