Recombinant Human CD160 Protein, C-His-tagged

• Cat.No.: CD160-014H
• Product Overview: Recombinant Human CD160 Protein with C-His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: CD160 antigen: rceptor on immune cells capable to deliver stimulatory or inhibitory signals that regulate cell activation and differentiation. Exists as a GPI-anchored and as a transmembrane form, each likely initiating distinct signaling pathways via phosphoinositol 3-kinase in activated NK cells and via LCK and CD247/CD3 zeta chain in activated T cells.
• Molecular Mass: ~15 kDa
• AA Sequence: GCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLS
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: CD160 CD160 molecule [ Homo sapiens (human) ]
• Official Symbol: CD160
• Synonyms: CD160; CD160 molecule; CD160 antigen; BY55; NK1; NK28; CD160-delta Ig; CD160 transmembrane isoform; natural killer cell receptor BY55; natural killer cell receptor, immunoglobulin superfamily member; FLJ46513
• Gene ID: 11126
• mRNA Refseq: NM_007053
• Protein Refseq: NP_008984
• MIM: 604463
• UniProt ID: O95971