Recombinant Human CD160 Protein, C-His-tagged
Cat.No. : | CD160-014H |
Product Overview : | Recombinant Human CD160 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | CD160 antigen: rceptor on immune cells capable to deliver stimulatory or inhibitory signals that regulate cell activation and differentiation. Exists as a GPI-anchored and as a transmembrane form, each likely initiating distinct signaling pathways via phosphoinositol 3-kinase in activated NK cells and via LCK and CD247/CD3 zeta chain in activated T cells. |
Molecular Mass : | ~15 kDa |
AA Sequence : | GCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLS |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD160 CD160 molecule [ Homo sapiens (human) ] |
Official Symbol | CD160 |
Synonyms | CD160; CD160 molecule; CD160 antigen; BY55; NK1; NK28; CD160-delta Ig; CD160 transmembrane isoform; natural killer cell receptor BY55; natural killer cell receptor, immunoglobulin superfamily member; FLJ46513; |
Gene ID | 11126 |
mRNA Refseq | NM_007053 |
Protein Refseq | NP_008984 |
MIM | 604463 |
UniProt ID | O95971 |
◆ Recombinant Proteins | ||
CD160-785H | Recombinant Human CD160 protein, hFc-tagged | +Inquiry |
CD160-115CAF555 | Recombinant Cynomolgus CD160 Protein, LEVLFQ-tagged, Alexa Fluor 555 conjugated | +Inquiry |
CD160-5331H | Active Recombinant Human CD160, Fc-tagged | +Inquiry |
CD160-453HAF647 | Active Recombinant Human CD160 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
CD160-314RAF488 | Recombinant Monkey CD160 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD160-2039HCL | Recombinant Human CD160 cell lysate | +Inquiry |
CD160-886CCL | Recombinant Cynomolgus CD160 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD160 Products
Required fields are marked with *
My Review for All CD160 Products
Required fields are marked with *
0
Inquiry Basket