Recombinant Human CD160 Protein, C-His-tagged
| Cat.No. : | CD160-014H |
| Product Overview : | Recombinant Human CD160 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | CD160 antigen: rceptor on immune cells capable to deliver stimulatory or inhibitory signals that regulate cell activation and differentiation. Exists as a GPI-anchored and as a transmembrane form, each likely initiating distinct signaling pathways via phosphoinositol 3-kinase in activated NK cells and via LCK and CD247/CD3 zeta chain in activated T cells. |
| Molecular Mass : | ~15 kDa |
| AA Sequence : | GCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLS |
| Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
| Notes : | For research use only, not for use in diagnostic procedure. |
| Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
| Concentration : | ≥0.5 mg/mL |
| Storage Buffer : | PBS, 4M Urea, pH7.4 |
| Gene Name | CD160 CD160 molecule [ Homo sapiens (human) ] |
| Official Symbol | CD160 |
| Synonyms | CD160; CD160 molecule; CD160 antigen; BY55; NK1; NK28; CD160-delta Ig; CD160 transmembrane isoform; natural killer cell receptor BY55; natural killer cell receptor, immunoglobulin superfamily member; FLJ46513; |
| Gene ID | 11126 |
| mRNA Refseq | NM_007053 |
| Protein Refseq | NP_008984 |
| MIM | 604463 |
| UniProt ID | O95971 |
| ◆ Recombinant Proteins | ||
| Cd160-916MAF555 | Recombinant Mouse Cd160 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| CD160-5330H | Active Recombinant Human CD160, MIgG2a Fc-tagged | +Inquiry |
| CD160-1435M | Recombinant Mouse CD160 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CD160-56H | Recombinant Human CD160 protein, His-tagged | +Inquiry |
| Cd160-916MF | Recombinant Mouse Cd160 Protein, Fc-tagged, FITC conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD160-886CCL | Recombinant Cynomolgus CD160 cell lysate | +Inquiry |
| CD160-2039HCL | Recombinant Human CD160 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD160 Products
Required fields are marked with *
My Review for All CD160 Products
Required fields are marked with *
