Recombinant Human CD160 Protein, C-His-tagged

Cat.No. : CD160-014H
Product Overview : Recombinant Human CD160 Protein with C-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : CD160 antigen: rceptor on immune cells capable to deliver stimulatory or inhibitory signals that regulate cell activation and differentiation. Exists as a GPI-anchored and as a transmembrane form, each likely initiating distinct signaling pathways via phosphoinositol 3-kinase in activated NK cells and via LCK and CD247/CD3 zeta chain in activated T cells.
Molecular Mass : ~15 kDa
AA Sequence : GCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLS
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name CD160 CD160 molecule [ Homo sapiens (human) ]
Official Symbol CD160
Synonyms CD160; CD160 molecule; CD160 antigen; BY55; NK1; NK28; CD160-delta Ig; CD160 transmembrane isoform; natural killer cell receptor BY55; natural killer cell receptor, immunoglobulin superfamily member; FLJ46513;
Gene ID 11126
mRNA Refseq NM_007053
Protein Refseq NP_008984
MIM 604463
UniProt ID O95971

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD160 Products

Required fields are marked with *

My Review for All CD160 Products

Required fields are marked with *

0
cart-icon
0
compare icon