Recombinant Human CD160 Protein, GST-Tagged
Cat.No. : | CD160-0724H |
Product Overview : | Human CD160 full-length ORF (NP_008984.1, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CD160 is an 27 kDa glycoprotein which was initially identified with the monoclonal antibody BY55. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. The cDNA sequence of CD160 predicts a cysteine-rich, glycosylphosphatidylinositol-anchored protein of 181 amino acids with a single Ig-like domain weakly homologous to KIR2DL4 molecule. CD160 is expressed at the cell surface as a tightly disulfide-linked multimer. RNA blot analysis revealed CD160 mRNAs of 1.5 and 1.6 kb whose expression was highly restricted to circulating NK and T cells, spleen and small intestine. Within NK cells CD160 is expressed by CD56dimCD16+ cells whereas among circulating T cells its expression is mainly restricted to TCRgd bearing cells and to TCRab+CD8brightCD95+CD56+CD28-CD27-cells. In tissues, CD160 is expressed on all intestinal intraepithelial lymphocytes. CD160 shows a broad specificity for binding to both classical and nonclassical MHC class I molecules. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 46.2 kDa |
AA Sequence : | MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQAL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD160 CD160 molecule [ Homo sapiens ] |
Official Symbol | CD160 |
Synonyms | CD160; CD160 molecule; CD160 antigen; BY55; NK1; NK28; CD160-delta Ig; CD160 transmembrane isoform; natural killer cell receptor BY55; natural killer cell receptor, immunoglobulin superfamily member; FLJ46513; |
Gene ID | 11126 |
mRNA Refseq | NM_007053 |
Protein Refseq | NP_008984 |
MIM | 604463 |
UniProt ID | O95971 |
◆ Recombinant Proteins | ||
CD160-453HF | Active Recombinant Human CD160 Protein, His-tagged, FITC conjugated | +Inquiry |
CD160-5331H | Active Recombinant Human CD160, Fc-tagged | +Inquiry |
CD160-785H | Recombinant Human CD160 protein, hFc-tagged | +Inquiry |
CD160-3036M | Recombinant Mouse CD160 Protein | +Inquiry |
CD160-453HAF488 | Active Recombinant Human CD160 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD160-2039HCL | Recombinant Human CD160 cell lysate | +Inquiry |
CD160-886CCL | Recombinant Cynomolgus CD160 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD160 Products
Required fields are marked with *
My Review for All CD160 Products
Required fields are marked with *