Recombinant Human CD163L1 protein(48-469aa), His&Myc-tagged
Cat.No. : | CD163L1-6432H |
Product Overview : | Recombinant Human CD163L1 protein(Q9NR16)(48-469aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 48-469aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 54.1 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | LRLVNGDGPCSGTVEVKFQGQWGTVCDDGWNTTASTVVCKQLGCPFSFAMFRFGQAVTRHGKIWLDDVSCYGNESALWECQHREWGSHNCYHGEDVGVNCYGEANLGLRLVDGNNSCSGRVEVKFQERWGTICDDGWNLNTAAVVCRQLGCPSSFISSGVVNSPAVLRPIWLDDILCQGNELALWNCRHRGWGNHDCSHNEDVTLTCYDSSDLELRLVGGTNRCMGRVELKIQGRWGTVCHHKWNNAAADVVCKQLGCGTALHFAGLPHLQSGSDVVWLDGVSCSGNESFLWDCRHSGTVNFDCLHQNDVSVICSDGADLELRLADGSNNCSGRVEVRIHEQWWTICDQNWKNEQALVVCKQLGCPFSVFGSRRAKPSNEARDIWINSISCTGNESALWDCTYDGKAKRTCFRRSDAGVICS |
Gene Name | CD163L1 CD163 molecule-like 1 [ Homo sapiens ] |
Official Symbol | CD163L1 |
Synonyms | CD163L1; CD163 molecule-like 1; CD163 antigen like 1; scavenger receptor cysteine-rich type 1 protein M160; CD163B; M160; CD163 antigen B; CD163 antigen-like 1; |
Gene ID | 283316 |
mRNA Refseq | NM_174941 |
Protein Refseq | NP_777601 |
MIM | 606079 |
UniProt ID | Q9NR16 |
◆ Recombinant Proteins | ||
CD163L1-3514B | Recombinant Bovine CD163L1, His-tagged | +Inquiry |
CD163L1-6432H | Recombinant Human CD163L1 protein(48-469aa), His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD163L1 Products
Required fields are marked with *
My Review for All CD163L1 Products
Required fields are marked with *
0
Inquiry Basket