Recombinant Human CD1C Protein, GST-Tagged
Cat.No. : | CD1C-0736H |
Product Overview : | Human CD1C partial ORF (NP_001756, 77 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene is broadly distributed throughout the endocytic system via a tyrosine-based motif in the cytoplasmic tail. Alternatively spliced transcript variants of this gene have been observed, but their full-length nature is not known. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 37.73 kDa |
AA Sequence : | SNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD1C CD1c molecule [ Homo sapiens ] |
Official Symbol | CD1C |
Synonyms | CD1C; CD1c molecule; CD1, CD1c antigen, CD1C antigen, c polypeptide; T-cell surface glycoprotein CD1c; CD1C antigen, c polypeptide; cortical thymocyte antigen CD1C; differentiation antigen CD1-alpha-3; R7; CD1; CD1A; BDCA1; |
Gene ID | 911 |
mRNA Refseq | NM_001765 |
Protein Refseq | NP_001756 |
MIM | 188340 |
UniProt ID | P29017 |
◆ Recombinant Proteins | ||
CD1C-5519H | Recombinant Human CD1C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CD1c-1456H | Recombinant Human CD1c Protein (Asn18-Met302), His tagged | +Inquiry |
CD1C-827H | Recombinant Human CD1C Protein, Fc-tagged | +Inquiry |
CD1C-0736H | Recombinant Human CD1C Protein, GST-Tagged | +Inquiry |
CD1C-2176C | Recombinant Chicken CD1C | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD1C-7682HCL | Recombinant Human CD1C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD1C Products
Required fields are marked with *
My Review for All CD1C Products
Required fields are marked with *
0
Inquiry Basket