"CD226" Related Products

Expand
Expand

Recombinant Human CD226 protein, T7/His-tagged

Cat.No.: CD226-139H
Product Overview: Recombinant human CD226 extracellular domain cDNA (19 - 254 aa, derived from BC074787) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSP THGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHI VSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVS DSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTLFVA
Purity: >90% by SDS-PAGE
Applications: 1. May be used as coating matrix protein or as soluble receptor for in vitro lymphocytes differentiation or activation regulations study.2. May be used for protein-protein interaction assay development.3. As antigen for specific antibody production.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: CD226 CD226 molecule [ Homo sapiens ]
Official Symbol: CD226
Synonyms: CD226; CD226 molecule; CD226 antigen; DNAM 1; DNAM1; PTA1; TLiSA1; adhesion glycoprotein; DNAX accessory molecule 1; DNAX accessory molecule-1; platelet and T cell activation antigen 1; T lineage-specific activation antigen 1 antigen; DNAM-1;
Gene ID: 10666
mRNA Refseq: NM_006566
Protein Refseq: NP_006557
MIM: 605397
UniProt ID: Q15762
Chromosome Location: 18q22.3
Pathway: Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Immune System, organism-specific biosystem; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell, organism-specific biosystem;
Function: cell adhesion molecule binding; integrin binding; protein binding; protein kinase binding; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.