Recombinant Human CD244 Protein, C-His-tagged
| Cat.No. : | CD244-113H |
| Product Overview : | Recombinant Human CD244 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | 2B4, also known as signaling lymphocytic activation molecule family member 4 (SLAMF4) and cluster of differentiation 244 (CD244), is a heterophilic cell surface receptor expressed on a variety of immune cells, including natural killer (NK) cells, T cells, eosinophils, mast cells, and dendritic cells. 2B4 has been shown to have both immune stimulatory and inhibitory effects on cells. Upon engagement of its ligand CD48, 2B4 can enhance immune cell signaling, cytokine production, non-major histocompatibility complex-restricted cytotoxicity, and cell migration. Conversely, at early stages of NK cell differentiation, 2B4 may function as an inhibitory receptor possibly ensuring the self-tolerance of developing NK cells. 2B4 also inhibits inflammatory responses in dendritic cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Molecular Mass : | ~23 kDa |
| AA Sequence : | CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFESLLPDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRFWP |
| Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
| Notes : | For research use only, not for use in diagnostic procedure. |
| Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
| Concentration : | ≥0.5 mg/mL |
| Storage Buffer : | PBS, 4M Urea, pH7.4 |
| Gene Name | CD244 CD244 molecule, natural killer cell receptor 2B4 [ Homo sapiens (human) ] |
| Official Symbol | CD244 |
| Synonyms | CD244; CD244 molecule, natural killer cell receptor 2B4; CD244 natural killer cell receptor 2B4 , natural killer cell receptor 2B4; natural killer cell receptor 2B4; 2B4; NAIL; NKR2B4; Nmrk; SLAMF4; h2B4; NK cell activation-inducing ligand; NK cell type I receptor protein 2B4; NK cell activation inducing ligand NAIL; |
| Gene ID | 51744 |
| mRNA Refseq | NM_001166663 |
| Protein Refseq | NP_001160135 |
| MIM | 605554 |
| UniProt ID | Q9BZW8 |
| ◆ Recombinant Proteins | ||
| CD244-110H | Recombinant Human CD244 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| CD244-578H | Recombinant Human CD244 Protein, Fc-tagged | +Inquiry |
| CD244-1826H | Recombinant Human CD244 Protein, Avi-tagged, Biotinylated | +Inquiry |
| CD244-1242R | Active Recombinant Rat CD244 protein, His-tagged | +Inquiry |
| CD244-580H | Recombinant Human CD244 protein(Met1-Arg221), hFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD244-2303HCL | Recombinant Human CD244 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD244 Products
Required fields are marked with *
My Review for All CD244 Products
Required fields are marked with *
