Recombinant Human CD244 protein, hFc-Myc-tagged
| Cat.No. : | CD244-6754H |
| Product Overview : | Recombinant Human CD244 protein(Q9BZW8)(22-221aa), fused with C-terminal hFc and Myc tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc&Myc |
| Protein Length : | 22-221aa |
| Tag : | C-hFc-Myc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 51.0 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFESLLPDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNA |
| Gene Name | CD244 CD244 molecule, natural killer cell receptor 2B4 [ Homo sapiens ] |
| Official Symbol | CD244 |
| Synonyms | CD244; CD244 molecule, natural killer cell receptor 2B4; CD244 natural killer cell receptor 2B4 , natural killer cell receptor 2B4; natural killer cell receptor 2B4; 2B4; NAIL; NKR2B4; Nmrk; SLAMF4; h2B4; NK cell activation-inducing ligand; NK cell type I receptor protein 2B4; NK cell activation inducing ligand NAIL; |
| Gene ID | 51744 |
| mRNA Refseq | NM_001166663 |
| Protein Refseq | NP_001160135 |
| MIM | 605554 |
| UniProt ID | Q9BZW8 |
| ◆ Recombinant Proteins | ||
| CD244-10930H | Recombinant Human CD244, His-tagged | +Inquiry |
| Cd244-1847M | Recombinant Mouse Cd244 protein, His & T7-tagged | +Inquiry |
| CD244-2851H | Active Recombinant Human CD244 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| CD244-717H | Recombinant Human CD244 Protein, His-tagged | +Inquiry |
| CD244-3039HF | Recombinant Full Length Human CD244 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD244-2303HCL | Recombinant Human CD244 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD244 Products
Required fields are marked with *
My Review for All CD244 Products
Required fields are marked with *
