Recombinant Human CD244 protein, hFc-Myc-tagged
Cat.No. : | CD244-6754H |
Product Overview : | Recombinant Human CD244 protein(Q9BZW8)(22-221aa), fused with C-terminal hFc and Myc tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc&Myc |
Protein Length : | 22-221aa |
Tag : | C-hFc-Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 51.0 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFESLLPDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNA |
Gene Name | CD244 CD244 molecule, natural killer cell receptor 2B4 [ Homo sapiens ] |
Official Symbol | CD244 |
Synonyms | CD244; CD244 molecule, natural killer cell receptor 2B4; CD244 natural killer cell receptor 2B4 , natural killer cell receptor 2B4; natural killer cell receptor 2B4; 2B4; NAIL; NKR2B4; Nmrk; SLAMF4; h2B4; NK cell activation-inducing ligand; NK cell type I receptor protein 2B4; NK cell activation inducing ligand NAIL; |
Gene ID | 51744 |
mRNA Refseq | NM_001166663 |
Protein Refseq | NP_001160135 |
MIM | 605554 |
UniProt ID | Q9BZW8 |
◆ Recombinant Proteins | ||
CD244-2851H | Active Recombinant Human CD244 protein, His-Avi-tagged, Biotinylated | +Inquiry |
CD244-1623R | Recombinant Rhesus Monkey CD244 Protein, hIgG1-tagged | +Inquiry |
CD244-580HAF647 | Recombinant Human CD244 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
CD244-2847H | Active Recombinant Human CD244 protein, His-Avi-tagged, Biotinylated | +Inquiry |
CD244-903HAF647 | Recombinant Human CD244 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD244-2303HCL | Recombinant Human CD244 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD244 Products
Required fields are marked with *
My Review for All CD244 Products
Required fields are marked with *
0
Inquiry Basket