"CD300c" Related Products

Expand

Recombinant Human CD300c protein, T7/His-tagged

Cat.No.: CD300c-73H
Product Overview: Recombinant human CD300c cDNA (21 – 183 aa, derived from BC022279) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFGYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCD KIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASS PQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro non-glycosylated CD300c protein mediated TH1 and TH17 cell function regulation with this protein as either coating matrix protein or soluble factor.2. May be used for CD300c protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As potential biomarker protein for differentiating patients with ulcerative colitis in Crohn"s disease from non-inflammatory diarrhea.5. As antigen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: CD300C CD300c molecule [ Homo sapiens ]
Official Symbol: CD300c
Synonyms: CD300C; CD300c molecule; CD300c antigen; CMRF35-like molecule 6; CMRF 35A; CMRF35; CMRF35A; IGSF16; LIR; CMRF35 antigen; CD300 antigen-like family member C; immunoglobulin superfamily member 16; CMRF35 leukocyte immunoglobulin-like receptor; CMRF35A leuko
Gene ID: 10871
mRNA Refseq: NM_006678
Protein Refseq: NP_006669
MIM: 606786
UniProt ID: Q08708
Chromosome Location: 17q25.2
Function: receptor activity; transmembrane signaling receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.