Recombinant Human CD300E, His-tagged
| Cat.No. : | CD300E-58H |
| Product Overview : | Recombinant Human CD300E is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Leu18-Leu169) of Human CD300E fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 18-169 a.a. |
| Description : | CD300E is a single-pass type I membrane protein that belongs to the CD300 family. CD300E has a single extracellular V-type Ig-like domain and presents on the surface of mature hematopoietic cells of the monocyte and myeloid lineages. CD300E acts as an activating receptor of the immunoglobulin (Ig) superfamily. It also mediates activating signals by interacting with DAP12. |
| Form : | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| AA Sequence : | LKGPGSVTGTAGDSLTVWCQYESMYKGYNKYWCRGQYDTSCESIVETKGEEKVERNGRVSIRDHP EALAFTVTMQNLNEDDAGSYWCKIQTVWVLDSWSRDPSDLVRVYVSPAITTPRRTTHPATPPIFL VVNPGRNLSTREVLTQNSGFRLVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Storage : | Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
| Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name | CD300E CD300e molecule [ Homo sapiens ] |
| Official Symbol | CD300E |
| Synonyms | CD300E; CD300e molecule; CD300 antigen like family member E , CD300e antigen , CD300LE; CMRF35-like molecule 2; CLM2; IREM2; CD300e antigen; poly-Ig receptor 2; CD300 antigen like family member E; CD300 antigen-like family member E; polymeric immunoglobulin receptor 2; immune receptor expressed on myeloid cells 2; CLM-2; PIgR2; IREM-2; PIgR-2; CD300LE; CMRF35-A5; |
| Gene ID | 342510 |
| mRNA Refseq | NM_181449 |
| Protein Refseq | NP_852114 |
| MIM | 609801 |
| UniProt ID | Q496F6 |
| Chromosome Location | 17q25.1 |
| Function | receptor activity; |
| ◆ Recombinant Proteins | ||
| CD300E-12H | Active Recombinant Human CD300E Protein, Fc-tagged, Alexa Fluor® 647 conjugated | +Inquiry |
| Cd300e-1267R | Recombinant Rat Cd300e Protein, His-tagged | +Inquiry |
| CD300E-1452M | Recombinant Mouse CD300E Protein, His (Fc)-Avi-tagged | +Inquiry |
| CD300E-4248H | Recombinant Human CD300E Protein (Met1-His173), C-Fc tagged | +Inquiry |
| CD300E-639H | Recombinant Human CD300e molecule, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD300E-316HCL | Recombinant Human CD300E cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD300E Products
Required fields are marked with *
My Review for All CD300E Products
Required fields are marked with *
