Recombinant Human CD300LB protein, His-tagged
Cat.No. : | CD300LB-2661H |
Product Overview : | Recombinant Human CD300LB protein(A8K4G0)(18-151aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 18-151aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.8 kDa |
AA Sequence : | IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CD300LB CD300 molecule-like family member b [ Homo sapiens ] |
Official Symbol | CD300LB |
Synonyms | CD_antigen=CD300b; CD300 antigen-like family member B; CD300 molecule-like family member b; CD300B; CLM 7; CLM7; CLM7_HUMAN; CMRF35 A2; CMRF35-like molecule 7; CMRF35A2; Immune receptor expressed on myeloid cells 3; IREM 3; IREM3; Leukocyte mono-Ig-like receptor 5; LMIR5; TREM 5; TREM5; Triggering receptor expressed on myeloid cells 5; UNQ2530/PRO6029; |
Gene ID | 124599 |
mRNA Refseq | NM_174892.2 |
Protein Refseq | NP_777552.2 |
MIM | 610705 |
UniProt ID | A8K4G0 |
◆ Recombinant Proteins | ||
CD300LB-1258H | Recombinant Human CD300LB protein, His-tagged | +Inquiry |
CD300LB-3133HF | Recombinant Full Length Human CD300LB Protein, GST-tagged | +Inquiry |
CD300LB-564H | Recombinant Human CD300LB Protein, Fc-tagged | +Inquiry |
CD300LB-565H | Recombinant Human CD300LB(Ile55-His187) Protein, C-Fc-tagged | +Inquiry |
CD300LB-0783H | Recombinant Human CD300LB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD300LB-176HCL | Recombinant Human CD300LB lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD300LB Products
Required fields are marked with *
My Review for All CD300LB Products
Required fields are marked with *