Recombinant Human CD300LF Protein (20-156 aa), His-tagged
Cat.No. : | CD300LF-1065H |
Product Overview : | Recombinant Human CD300LF Protein (20-156 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 20-156 aa |
Description : | Acts as an inhibitory receptor for myeloid cells and mast cells. Inhibits osteoclast formation. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 19.5 kDa |
AA Sequence : | TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | CD300LF CD300 molecule-like family member f [ Homo sapiens ] |
Official Symbol | CD300LF |
Synonyms | CD300LF; CD300f; CLM1; IGSF13; IREM1; NKIR; CLM-1; IREM-1; IgSF13; |
Gene ID | 146722 |
mRNA Refseq | NM_139018 |
Protein Refseq | NP_620587 |
MIM | 609807 |
UniProt ID | Q8TDQ1 |
◆ Recombinant Proteins | ||
H1F0-4035M | Recombinant Mouse H1F0 Protein, His (Fc)-Avi-tagged | +Inquiry |
STK17A-2678C | Recombinant Chicken STK17A | +Inquiry |
IFNB1-979P | Recombinant Pig IFNB1 Protein, His-tagged | +Inquiry |
IL17D-248H | Recombinant Human IL17D Protein (Ala18-Pro202), N-His tagged, Animal-free, Carrier-free | +Inquiry |
GPD1-9213HFL | Recombinant Full Length Human GPD1 protein, Flag-tagged | +Inquiry |
◆ Native Proteins | ||
Acid phosphatase-158 | Active Native Wheat Germ Acid phosphatase Protein | +Inquiry |
Neuraminidase-009C | Active Native Clostridium perfringens Neuraminidase, Type VIII | +Inquiry |
LDH-227H | Active Native Human Lactate Dehydrogenase Total | +Inquiry |
Blood-011H | Human Blood Lysate, Total Protein | +Inquiry |
ALB-7993H | Native Human Serum Albumin(20% Solution) | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKIP1-8354HCL | Recombinant Human C11orf17 293 Cell Lysate | +Inquiry |
PRKCD-546MCL | Recombinant Mouse PRKCD cell lysate | +Inquiry |
ACE2-2085MCL | Recombinant Mouse ACE2 cell lysate | +Inquiry |
BMPR2-2717HCL | Recombinant Human BMPR2 cell lysate | +Inquiry |
MRO-4200HCL | Recombinant Human MRO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD300LF Products
Required fields are marked with *
My Review for All CD300LF Products
Required fields are marked with *
0
Inquiry Basket