Recombinant Human CD300LF Protein (20-156 aa), His-tagged
| Cat.No. : | CD300LF-1065H |
| Product Overview : | Recombinant Human CD300LF Protein (20-156 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 20-156 aa |
| Description : | Acts as an inhibitory receptor for myeloid cells and mast cells. Inhibits osteoclast formation. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 19.5 kDa |
| AA Sequence : | TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | CD300LF CD300 molecule-like family member f [ Homo sapiens ] |
| Official Symbol | CD300LF |
| Synonyms | CD300LF; CD300f; CLM1; IGSF13; IREM1; NKIR; CLM-1; IREM-1; IgSF13; |
| Gene ID | 146722 |
| mRNA Refseq | NM_139018 |
| Protein Refseq | NP_620587 |
| MIM | 609807 |
| UniProt ID | Q8TDQ1 |
| ◆ Recombinant Proteins | ||
| CD300LF-174H | Recombinant Human CD300LF Protein, His (Fc)-Avi-tagged | +Inquiry |
| CD300LF-412H | Active Recombinant Human CD300LF, Fc Chimera | +Inquiry |
| CD300LF-2259R | Recombinant Rat CD300LF Protein (19-181 aa), His-SUMO-Myc-tagged | +Inquiry |
| CD300LF-903R | Recombinant Rat CD300LF Protein, His (Fc)-Avi-tagged | +Inquiry |
| CD300LF-1454M | Recombinant Mouse CD300LF Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD300LF Products
Required fields are marked with *
My Review for All CD300LF Products
Required fields are marked with *



