Recombinant Human CD300LF Protein (20-156 aa), His-tagged

Cat.No. : CD300LF-1065H
Product Overview : Recombinant Human CD300LF Protein (20-156 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 20-156 aa
Description : Acts as an inhibitory receptor for myeloid cells and mast cells. Inhibits osteoclast formation.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 19.5 kDa
AA Sequence : TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name CD300LF CD300 molecule-like family member f [ Homo sapiens ]
Official Symbol CD300LF
Synonyms CD300LF; CD300f; CLM1; IGSF13; IREM1; NKIR; CLM-1; IREM-1; IgSF13;
Gene ID 146722
mRNA Refseq NM_139018
Protein Refseq NP_620587
MIM 609807
UniProt ID Q8TDQ1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD300LF Products

Required fields are marked with *

My Review for All CD300LF Products

Required fields are marked with *

0
cart-icon
0
compare icon