Recombinant Human CD300LF Protein (20-156 aa), His-tagged
Cat.No. : | CD300LF-1692H |
Product Overview : | Recombinant Human CD300LF Protein (20-156 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 20-156 aa |
Description : | Acts as an inhibitory receptor for myeloid cells and mast cells. Inhibits osteoclast formation. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 17.5 kDa |
AA Sequence : | TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | CD300LF CD300 molecule-like family member f [ Homo sapiens ] |
Official Symbol | CD300LF |
Synonyms | CD300LF; CD300f; CLM1; IGSF13; IREM1; NKIR; CLM-1; IREM-1; IgSF13; |
Gene ID | 146722 |
mRNA Refseq | NM_139018 |
Protein Refseq | NP_620587 |
MIM | 609807 |
UniProt ID | Q8TDQ1 |
◆ Recombinant Proteins | ||
Cd300lf-1269M | Recombinant Mouse Cd300lf Protein, His-tagged | +Inquiry |
CD300LF-629H | Recombinant Human CD300LF Protein (Met1-Leu155), His-tagged | +Inquiry |
CD300LF-2259R | Recombinant Rat CD300LF Protein (19-181 aa), His-SUMO-Myc-tagged | +Inquiry |
CD300LF-1454M | Recombinant Mouse CD300LF Protein, His (Fc)-Avi-tagged | +Inquiry |
CD300LF-3076M | Recombinant Mouse CD300LF Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD300LF Products
Required fields are marked with *
My Review for All CD300LF Products
Required fields are marked with *