Recombinant Human CD300LG Protein, His-tagged
| Cat.No. : | CD300LG-149H |
| Product Overview : | Recombinant human CD300LG protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 332 |
| Description : | Members of the CD300 (see MIM 606786)-like (CD300L) family, such as CD300LG, are widely expressed on hematopoietic cells. All CD300L proteins are type I cell surface glycoproteins that contain a single immunoglobulin (Ig) V-like domain. |
| Form : | Lyophilized |
| Molecular Mass : | 25.6 kDa |
| AA Sequence : | MRLLVLLWGCLLLPGYEALEGPEEISGFEGDTVSLQCTYREELRDHRKYWCRKGGILFSRCSGTIYAEEEGQETMKGRVSIRDSRQELSLIVTLWNLTLQDAGEYWCGVEKRGPDESLLISLFVFPGPCCPPSPSPTFQPLATTRLQPKAKAQQTQPPGLTSPGLYPAATTAKQGKTGAEAPPLPGTSQYGHERTSQYTGTSPHPATSPPAGSSRPPMQLDSTSAEDTSPALSSGSSKPRVSIPMVRILAPVLVLLSLLSAAGLIAFCSHLLLWRKEAQQATETQRNEKFCLSRLTAEEKEAPSQAPEGDVISMPPLHTSEEELGFSKFVSA |
| Purity : | > 98% |
| Applications : | WB; ELISA; FACS; FC |
| Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : | At -20 centigrade. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
| Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
| Gene Name | CD300LG CD300 molecule-like family member g [ Homo sapiens (human) ] |
| Official Symbol | CD300LG |
| Synonyms | CLM9; CLM-9; TREM4; TREM-4; NEPMUCIN |
| Gene ID | 146894 |
| mRNA Refseq | NM_145273 |
| Protein Refseq | NP_660316 |
| MIM | 610520 |
| UniProt ID | Q6UXG3 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD300LG Products
Required fields are marked with *
My Review for All CD300LG Products
Required fields are marked with *



