"CD320" Related Products

Expand
Expand
Expand

Recombinant Human CD320 Protein

Cat.No. : CD320-0787H
Product Overview : Human CD320 full-length ORF (NP_057663.1) recombinant protein without tag.
Description : This gene encodes the transcobalamin receptor that is expressed at the cell surface. It mediates the cellular uptake of transcobalamin bound cobalamin (vitamin B12), and is involved in B-cell proliferation and immunoglobulin secretion. Mutations in this gene are associated with methylmalonic aciduria. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jan 2011]
Source : Wheat Germ
Species : Human
Form : Liquid
Molecular Mass : 29 kDa
AA Sequence : MSGGWMAQVGAWRTGALGLALLLLLGLGLGLEAAASPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVIAAAAVLSASLVTATLLLLSWLRAQERLRPLGLLVAMKESLLLSEQKTSLP
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name : CD320 CD320 molecule [ Homo sapiens (human) ]
Official Symbol : CD320
Synonyms : CD320; CD320 molecule; 8D6; 8D6A; TCBLR; CD320 antigen; 8D6 antigen; FDC-SM-8D6; FDC-signaling molecule 8D6; transcobalamin receptor; CD320 Antigen; 8D6 Antigen; FDC-Signaling Molecule 8D6; Transcobalamin Receptor; FDC-SM-8D6
Gene ID : 51293
mRNA Refseq : NM_001165895
Protein Refseq : NP_001159367
MIM : 606475
UniProt ID : Q9NPF0

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.