Recombinant Human CD320 Protein
Cat.No. : | CD320-0787H |
Product Overview : | Human CD320 full-length ORF (NP_057663.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | This gene encodes the transcobalamin receptor that is expressed at the cell surface. It mediates the cellular uptake of transcobalamin bound cobalamin (vitamin B12), and is involved in B-cell proliferation and immunoglobulin secretion. Mutations in this gene are associated with methylmalonic aciduria. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jan 2011] |
Form : | Liquid |
Molecular Mass : | 29 kDa |
AA Sequence : | MSGGWMAQVGAWRTGALGLALLLLLGLGLGLEAAASPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVIAAAAVLSASLVTATLLLLSWLRAQERLRPLGLLVAMKESLLLSEQKTSLP |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | CD320 CD320 molecule [ Homo sapiens (human) ] |
Official Symbol | CD320 |
Synonyms | CD320; CD320 molecule; 8D6; 8D6A; TCBLR; CD320 antigen; 8D6 antigen; FDC-SM-8D6; FDC-signaling molecule 8D6; transcobalamin receptor; CD320 Antigen; 8D6 Antigen; FDC-Signaling Molecule 8D6; Transcobalamin Receptor; FDC-SM-8D6 |
Gene ID | 51293 |
mRNA Refseq | NM_001165895 |
Protein Refseq | NP_001159367 |
MIM | 606475 |
UniProt ID | Q9NPF0 |
◆ Recombinant Proteins | ||
CD320-1458M | Recombinant Mouse CD320 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD320-905R | Recombinant Rat CD320 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cd320-980M | Active Recombinant Mouse Cd320 protein, His-tagged | +Inquiry |
CD320-151H | Recombinant Human CD320 Protein, His-tagged | +Inquiry |
CD320-1729R | Recombinant Rhesus Monkey CD320 Protein, hIgG1-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD320-001MCL | Recombinant Mouse CD320 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD320 Products
Required fields are marked with *
My Review for All CD320 Products
Required fields are marked with *
0
Inquiry Basket