Recombinant Human CD34 protein
Cat.No. : | CD34-266H |
Product Overview : | Recombinant Human CD34, transcript variant 1, was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Tag : | Non |
Description : | Possible adhesion molecule with a role in early hematopoiesis by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. Could act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. Presents carbohydrate ligands to selectins. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2 |
Molecular Mass : | 27 kDa |
AA Sequence : | LDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Resuspend the protein in the desired concentration in proper buffer |
Gene Name | CD34 CD34 molecule [ Homo sapiens ] |
Official Symbol | CD34 |
Synonyms | CD34; CD34 molecule; CD34 antigen; hematopoietic progenitor cell antigen CD34; |
Gene ID | 947 |
mRNA Refseq | NM_001025109 |
Protein Refseq | NP_001020280 |
MIM | 142230 |
UniProt ID | P28906 |
◆ Recombinant Proteins | ||
RFL26530HF | Recombinant Full Length Human Hematopoietic Progenitor Cell Antigen Cd34(Cd34) Protein, His-Tagged | +Inquiry |
CD34-151H | Recombinant Human CD34 Protein, DYKDDDDK-tagged | +Inquiry |
CD34-152H | Recombinant Human CD34 Protein, DYKDDDDK-tagged | +Inquiry |
CD34-2710H | Recombinant Human CD34 protein(81-220 aa), C-His-tagged | +Inquiry |
Cd34-2019M | Recombinant Mouse Cd34 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD34-1408RCL | Recombinant Rat CD34 cell lysate | +Inquiry |
CD34-2232MCL | Recombinant Mouse CD34 cell lysate | +Inquiry |
CD34-3047HCL | Recombinant Human CD34 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD34 Products
Required fields are marked with *
My Review for All CD34 Products
Required fields are marked with *
0
Inquiry Basket