Recombinant Human CD34 protein

• Cat.No.: CD34-266H
• Product Overview: Recombinant Human CD34, transcript variant 1, was expressed in CHO.

Specification

• Species: Human
• Source: CHO
• Tag: Non
• Description: Possible adhesion molecule with a role in early hematopoiesis by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. Could act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. Presents carbohydrate ligands to selectins.
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2
• Molecular Mass: 27 kDa
• AA Sequence: LDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Resuspend the protein in the desired concentration in proper buffer

Gene Information

• Gene Name: CD34 CD34 molecule [ Homo sapiens ]
• Official Symbol: CD34
• Synonyms: CD34; CD34 molecule; CD34 antigen; hematopoietic progenitor cell antigen CD34
• Gene ID: 947
• mRNA Refseq: NM_001025109
• Protein Refseq: NP_001020280
• MIM: 142230
• UniProt ID: P28906