Recombinant Human CD34 protein

Cat.No. : CD34-266H
Product Overview : Recombinant Human CD34, transcript variant 1, was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Tag : Non
Description : Possible adhesion molecule with a role in early hematopoiesis by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. Could act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. Presents carbohydrate ligands to selectins.
Form : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2
Molecular Mass : 27 kDa
AA Sequence : LDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Resuspend the protein in the desired concentration in proper buffer
Gene Name CD34 CD34 molecule [ Homo sapiens ]
Official Symbol CD34
Synonyms CD34; CD34 molecule; CD34 antigen; hematopoietic progenitor cell antigen CD34;
Gene ID 947
mRNA Refseq NM_001025109
Protein Refseq NP_001020280
MIM 142230
UniProt ID P28906

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD34 Products

Required fields are marked with *

My Review for All CD34 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon