Recombinant Human CD3E

Cat.No. : CD3E-26926TH
Product Overview : Recombinant full length mature Human CD3 epsilon with N terminal proprietary tag; predicted MWt 46.46 kDa inclusive of tag
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.
Protein length : 185 amino acids
Molecular Weight : 46.460kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQRN DKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRG SKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITG GLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPP VPNPDYEPIRKGQRDLYSGLNQRRI
Sequence Similarities : Contains 1 Ig-like (immunoglobulin-like) domain.Contains 1 ITAM domain.
Tag : Non
Gene Name : CD3E CD3e molecule, epsilon (CD3-TCR complex) [ Homo sapiens ]
Official Symbol : CD3E
Synonyms : CD3E; CD3e molecule, epsilon (CD3-TCR complex); CD3e antigen, epsilon polypeptide (TiT3 complex); T-cell surface glycoprotein CD3 epsilon chain;
Gene ID : 916
mRNA Refseq : NM_000733
Protein Refseq : NP_000724
Uniprot ID : P07766
Chromosome Location : 11q23
Pathway : Adaptive Immune System, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem;
Function : SH3 domain binding; T cell receptor binding; protein heterodimerization activity; protein kinase binding; receptor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Reviews
  • Q&As

Customer Reviews (3)

Write a review
Reviews
03/22/2023

    Manufacturers with the capacity for bulk production can offer CD3E protein in larger quantities, which is advantageous for researchers working on large-scale experiments or collaborations.

    09/12/2021

      bulk production often leads to economies of scale, making the CD3E protein more cost-effective for research budgets.

      06/17/2018

        Manufacturers can actively seek collaborations and partnerships with researchers to develop new applications or optimize methodologies using CD3E protein.

        Q&As (5)

        Ask a question
        Can CD3E be used to assess the effectiveness of cancer immunotherapies? 04/07/2021

        Yes, CD3E levels and T-cell function can be monitored to evaluate the response to cancer immunotherapies like checkpoint inhibitors.

        Are there any CD3E-targeted therapies? 06/01/2017

        There are currently no approved therapies that directly target CD3E, but it is a target for research in developing immunotherapies and cancer treatments.

        Are there any ongoing clinical trials involving CD3E? 12/20/2016

        There may be ongoing clinical trials using CD3E-targeted therapies in the context of cancer and autoimmune diseases. It's important to check clinical trial databases for specific studies.

        Can CD3E levels be used to monitor the progression of HIV? 08/27/2016

        Yes, monitoring CD3E levels in HIV-infected individuals can provide valuable information about the progression of the disease and the effectiveness of antiretroviral therapy.

        How is CD3E used in allergy diagnostics? 06/22/2016

        CD3E can be used in research to study T-cell responses in allergic conditions, helping to better understand and diagnose allergies.

        Ask a Question for All CD3E Products

        Required fields are marked with *

        My Review for All CD3E Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /
        • Service lnquiry:

        Stay Updated on the Latest Bioscience Trends