Recombinant Human CD3E

Cat.No. : CD3E-26926TH
Product Overview : Recombinant full length mature Human CD3 epsilon with N terminal proprietary tag; predicted MWt 46.46 kDa inclusive of tag
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 185 amino acids
Description : The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.
Molecular Weight : 46.460kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQRN DKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRG SKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITG GLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPP VPNPDYEPIRKGQRDLYSGLNQRRI
Sequence Similarities : Contains 1 Ig-like (immunoglobulin-like) domain.Contains 1 ITAM domain.
Gene Name CD3E CD3e molecule, epsilon (CD3-TCR complex) [ Homo sapiens ]
Official Symbol CD3E
Synonyms CD3E; CD3e molecule, epsilon (CD3-TCR complex); CD3e antigen, epsilon polypeptide (TiT3 complex); T-cell surface glycoprotein CD3 epsilon chain;
Gene ID 916
mRNA Refseq NM_000733
Protein Refseq NP_000724
Uniprot ID P07766
Chromosome Location 11q23
Pathway Adaptive Immune System, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem;
Function SH3 domain binding; T cell receptor binding; protein heterodimerization activity; protein kinase binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD3E Products

Required fields are marked with *

My Review for All CD3E Products

Required fields are marked with *

0
cart-icon
0
compare icon