Recombinant Human CD3E
Cat.No. : | CD3E-26926TH |
Product Overview : | Recombinant full length mature Human CD3 epsilon with N terminal proprietary tag; predicted MWt 46.46 kDa inclusive of tag |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 185 amino acids |
Description : | The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. |
Molecular Weight : | 46.460kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQRN DKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRG SKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITG GLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPP VPNPDYEPIRKGQRDLYSGLNQRRI |
Sequence Similarities : | Contains 1 Ig-like (immunoglobulin-like) domain.Contains 1 ITAM domain. |
Gene Name | CD3E CD3e molecule, epsilon (CD3-TCR complex) [ Homo sapiens ] |
Official Symbol | CD3E |
Synonyms | CD3E; CD3e molecule, epsilon (CD3-TCR complex); CD3e antigen, epsilon polypeptide (TiT3 complex); T-cell surface glycoprotein CD3 epsilon chain; |
Gene ID | 916 |
mRNA Refseq | NM_000733 |
Protein Refseq | NP_000724 |
Uniprot ID | P07766 |
Chromosome Location | 11q23 |
Pathway | Adaptive Immune System, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; |
Function | SH3 domain binding; T cell receptor binding; protein heterodimerization activity; protein kinase binding; receptor activity; |
◆ Recombinant Proteins | ||
CD3E-143H | Recombinant Human CD3E Protein, Strep-tagged | +Inquiry |
CD3E-982R | Recombinant Rhesus CD3E Protein (Met1-Asp117), His-Fc-tagged | +Inquiry |
CD3E-039H | Recombinant Human CD3E Protein, ECD, Tag Free, Biotinylated | +Inquiry |
CD3E & CD3G-1961M | Recombinant Mouse CD3E & CD3G protein, hFc-tagged | +Inquiry |
RFL22526HF | Recombinant Full Length Human T-Cell Surface Glycoprotein Cd3 Epsilon Chain(Cd3E) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD3E-1275HCL | Recombinant Human CD3E cell lysate | +Inquiry |
CD3E-1602CCL | Recombinant Cynomolgus CD3E cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD3E Products
Required fields are marked with *
My Review for All CD3E Products
Required fields are marked with *