Recombinant Human CD3E
Cat.No. : | CD3E-26926TH |
Product Overview : | Recombinant full length mature Human CD3 epsilon with N terminal proprietary tag; predicted MWt 46.46 kDa inclusive of tag |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. |
Protein length : | 185 amino acids |
Molecular Weight : | 46.460kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQRN DKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRG SKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITG GLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPP VPNPDYEPIRKGQRDLYSGLNQRRI |
Sequence Similarities : | Contains 1 Ig-like (immunoglobulin-like) domain.Contains 1 ITAM domain. |
Tag : | Non |
Gene Name : | CD3E CD3e molecule, epsilon (CD3-TCR complex) [ Homo sapiens ] |
Official Symbol : | CD3E |
Synonyms : | CD3E; CD3e molecule, epsilon (CD3-TCR complex); CD3e antigen, epsilon polypeptide (TiT3 complex); T-cell surface glycoprotein CD3 epsilon chain; |
Gene ID : | 916 |
mRNA Refseq : | NM_000733 |
Protein Refseq : | NP_000724 |
Uniprot ID : | P07766 |
Chromosome Location : | 11q23 |
Pathway : | Adaptive Immune System, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; |
Function : | SH3 domain binding; T cell receptor binding; protein heterodimerization activity; protein kinase binding; receptor activity; |
Products Types
◆ Recombinant Protein | ||
CD3E-140C | Recombinant Cynomolgus monkey CD3E Protein, His and Fc-tagged | +Inquiry |
CD3E-143H | Recombinant Human CD3E Protein, Strep-tagged | +Inquiry |
CD3E-1085M | Recombinant Mouse CD3E Protein (Met1-Asp108), His-Fc-tagged, Biotinylated | +Inquiry |
CD3E-675H | Recombinant Human CD3E Protein, His-tagged | +Inquiry |
CD3E-169H | Recombinant Human CD3E Protein, C-His-tagged | +Inquiry |
◆ Lysates | ||
CD3E-1602CCL | Recombinant Cynomolgus CD3E cell lysate | +Inquiry |
CD3E-1275HCL | Recombinant Human CD3E cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Reviews
- Q&As
Customer Reviews (3)
Write a reviewManufacturers with the capacity for bulk production can offer CD3E protein in larger quantities, which is advantageous for researchers working on large-scale experiments or collaborations.
bulk production often leads to economies of scale, making the CD3E protein more cost-effective for research budgets.
Manufacturers can actively seek collaborations and partnerships with researchers to develop new applications or optimize methodologies using CD3E protein.
Q&As (5)
Ask a questionYes, CD3E levels and T-cell function can be monitored to evaluate the response to cancer immunotherapies like checkpoint inhibitors.
There are currently no approved therapies that directly target CD3E, but it is a target for research in developing immunotherapies and cancer treatments.
There may be ongoing clinical trials using CD3E-targeted therapies in the context of cancer and autoimmune diseases. It's important to check clinical trial databases for specific studies.
Yes, monitoring CD3E levels in HIV-infected individuals can provide valuable information about the progression of the disease and the effectiveness of antiretroviral therapy.
CD3E can be used in research to study T-cell responses in allergic conditions, helping to better understand and diagnose allergies.
Ask a Question for All CD3E Products
Required fields are marked with *
My Review for All CD3E Products
Required fields are marked with *
Inquiry Basket