Recombinant Human CD3E Protein, His-tagged, Biotinylated

Name: Recombinant Human CD3E Protein, His-tagged, Biotinylated
SKU: CD3E-138H

Species :	Human
Source :	HEK293
Tag :	His
Protein Length :	207
Description :	The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.
Form :	Lyophilized
Molecular Mass :	13.2 kDa
AA Sequence :	MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Purity :	> 98%
Applications :	WB; ELISA; FACS; FC
Stability :	This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage :	At -20 centigrade.
Concentration :	1 mg/mL
Storage Buffer :	PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution :	Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Conjugation :	Biotin

Gene Name	CD3E CD3e molecule, epsilon (CD3-TCR complex) [ Homo sapiens (human) ]
Official Symbol	CD3E
Synonyms	CD3E; CD3e molecule, epsilon (CD3-TCR complex); CD3e antigen, epsilon polypeptide (TiT3 complex); T-cell surface glycoprotein CD3 epsilon chain; CD3-epsilon; T-cell surface antigen T3/Leu-4 epsilon chain; T-cell antigen receptor complex, epsilon subunit of T3; T3E; TCRE; FLJ18683;
Gene ID	916
mRNA Refseq	NM_000733
Protein Refseq	NP_000724
MIM	186830
UniProt ID	P07766