Recombinant Human CD55 protein(231-350 aa), C-His-tagged

Cat.No. : CD55-2590H
Product Overview : Recombinant Human CD55 protein(P08174)(231-350 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 231-350 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : IDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSG
Gene Name CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) [ Homo sapiens ]
Official Symbol CD55
Synonyms CD55; CD55 molecule, decay accelerating factor for complement (Cromer blood group); DAF, decay accelerating factor for complement (CD55, Cromer blood group system); complement decay-accelerating factor; CR; CROM; TC; CD55 antigen; DAF;
Gene ID 1604
mRNA Refseq NM_000574
Protein Refseq NP_000565
MIM 125240
UniProt ID P08174

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD55 Products

Required fields are marked with *

My Review for All CD55 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon