Recombinant Human CD55 protein(231-350 aa), C-His-tagged
Cat.No. : | CD55-2590H |
Product Overview : | Recombinant Human CD55 protein(P08174)(231-350 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 231-350 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | IDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSG |
Gene Name | CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) [ Homo sapiens ] |
Official Symbol | CD55 |
Synonyms | CD55; CD55 molecule, decay accelerating factor for complement (Cromer blood group); DAF, decay accelerating factor for complement (CD55, Cromer blood group system); complement decay-accelerating factor; CR; CROM; TC; CD55 antigen; DAF; |
Gene ID | 1604 |
mRNA Refseq | NM_000574 |
Protein Refseq | NP_000565 |
MIM | 125240 |
UniProt ID | P08174 |
◆ Recombinant Proteins | ||
CD55-64HAF488 | Recombinant Human CD55 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
CD55-64HF | Recombinant Human CD55 Protein, Fc-tagged, FITC conjugated | +Inquiry |
Cd55-7191M | Recombinant Mouse Cd55 Protein, His-tagged | +Inquiry |
CD55-164H | Recombinant Human CD55 Protein, His-tagged | +Inquiry |
CD55-1046H | Recombinant Human CD55 Protein (Asp35-Gly285), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD55-1433RCL | Recombinant Rat CD55 cell lysate | +Inquiry |
CD55-1669MCL | Recombinant Mouse CD55 cell lysate | +Inquiry |
CD55-2531HCL | Recombinant Human CD55 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD55 Products
Required fields are marked with *
My Review for All CD55 Products
Required fields are marked with *