Recombinant Human CD55 Protein (35-353aa), C-His-tagged
Cat.No. : | CD55-01H |
Product Overview : | Recombinant human CD55 (35-353aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
Availability | August 26, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 35-353 |
Description : | This gene encodes a glycoprotein involved in the regulation of the complement cascade. Binding of the encoded protein to complement proteins accelerates their decay, thereby disrupting the cascade and preventing damage to host cells. Antigens present on this protein constitute the Cromer blood group system (CROM). Alternative splicing results in multiple transcript variants. The predominant transcript variant encodes a membrane-bound protein, but alternatively spliced transcripts may produce soluble proteins. |
Form : | Liquid |
Molecular Mass : | 36 kDa (328aa) |
AA Sequence : | ADPDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSHHHHHH |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by BCA assay) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | CD55 CD55 molecule (Cromer blood group) [ Homo sapiens (human) ] |
Official Symbol | CD55 |
Synonyms | CD55; CD55 molecule (Cromer blood group); CR; TC; DAF; CROM; CHAPLE; complement decay-accelerating factor; CD55 antigen; CD55 molecule, decay accelerating factor for complement (Cromer blood group); Cromer blood group antigen; Rh blood group D antigen |
Gene ID | 1604 |
mRNA Refseq | NM_000574 |
Protein Refseq | NP_000565 |
MIM | 125240 |
UniProt ID | P08174 |
◆ Recombinant Proteins | ||
CD55-3161H | Recombinant Human CD55 protein, His-tagged | +Inquiry |
CD55-151H | Recombinant Human CD55 Protein, His-tagged | +Inquiry |
CD55-64HAF555 | Recombinant Human CD55 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
Cd55-57M | Recombinant Mouse Cd55 Protein, His-tagged | +Inquiry |
Cd55-695M | Recombinant Mouse Cd55 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD55-2531HCL | Recombinant Human CD55 cell lysate | +Inquiry |
CD55-1669MCL | Recombinant Mouse CD55 cell lysate | +Inquiry |
CD55-1433RCL | Recombinant Rat CD55 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD55 Products
Required fields are marked with *
My Review for All CD55 Products
Required fields are marked with *