Recombinant Human CD55 Protein (35-353aa), C-His-tagged

Cat.No. : CD55-01H
Product Overview : Recombinant human CD55 (35-353aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Availability May 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 35-353
Description : This gene encodes a glycoprotein involved in the regulation of the complement cascade. Binding of the encoded protein to complement proteins accelerates their decay, thereby disrupting the cascade and preventing damage to host cells. Antigens present on this protein constitute the Cromer blood group system (CROM). Alternative splicing results in multiple transcript variants. The predominant transcript variant encodes a membrane-bound protein, but alternatively spliced transcripts may produce soluble proteins.
Form : Liquid
Molecular Mass : 36 kDa (328aa)
AA Sequence : ADPDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSHHHHHH
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by BCA assay)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name CD55 CD55 molecule (Cromer blood group) [ Homo sapiens (human) ]
Official Symbol CD55
Synonyms CD55; CD55 molecule (Cromer blood group); CR; TC; DAF; CROM; CHAPLE; complement decay-accelerating factor; CD55 antigen; CD55 molecule, decay accelerating factor for complement (Cromer blood group); Cromer blood group antigen; Rh blood group D antigen
Gene ID 1604
mRNA Refseq NM_000574
Protein Refseq NP_000565
MIM 125240
UniProt ID P08174

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD55 Products

Required fields are marked with *

My Review for All CD55 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon