Recombinant Human CD58 Protein, His-tagged
Cat.No. : | CD58-201H |
Product Overview : | Recombinant Human CD58 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | CD2 (also designated E-rosette receptor) interacts through its amino-terminal domain with the extracellular domain of CD58 (also designated CD2 ligand) to mediate cell adhesion. CD2/CD58 binding can enhance antigen-specific T cell activation. CD2 is a transmembrane glycoprotein that is expressed on T lymphocytes, NK cells and thymocytes, as well as on mouse B cells and rat splenic macrophages. CD58 is a heavily glycosylated protein with a broad tissue distribution in hematopoietic and other cells, including endothelium. |
Molecular Mass : | ~24 kDa |
AA Sequence : | FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD58 CD58 molecule [ Homo sapiens (human) ] |
Official Symbol | CD58 |
Synonyms | CD58; CD58 molecule; CD58 antigen, (lymphocyte function associated antigen 3) , LFA3; lymphocyte function-associated antigen 3; surface glycoprotein LFA-3; CD58 antigen, (lymphocyte function-associated antigen 3); ag3; LFA3; LFA-3; FLJ23181; FLJ43722; |
Gene ID | 965 |
mRNA Refseq | NM_001144822 |
Protein Refseq | NP_001138294 |
MIM | 153420 |
UniProt ID | P19256 |
◆ Recombinant Proteins | ||
CD58-1240H | Recombinant Human CD58 Protein (Met1-Arg215), C-His tagged | +Inquiry |
CD58-005H | Recombinant Human CD58 Protein, DDK/His-tagged | +Inquiry |
CD58-246H | Recombinant Human CD58 Protein, His-tagged | +Inquiry |
CD58-0834H | Recombinant Human CD58 Protein | +Inquiry |
CD58-4137H | Recombinant Human CD58 Molecule | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD58-1127HCL | Recombinant Human CD58 cell lysate | +Inquiry |
CD58-797CCL | Recombinant Cynomolgus CD58 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD58 Products
Required fields are marked with *
My Review for All CD58 Products
Required fields are marked with *