Recombinant Human CD68 Protein, C-His-tagged
| Cat.No. : | CD68-204H |
| Product Overview : | Recombinant Human CD68 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | CD68 (macrosialin) is a heavily glycosylated transmembrane protein that is expressed by and commonly used as a marker for monocytes and macrophages. It is found on the plasma membrane, as well as endosomal and lysosomal membranes. It is proposed to bind OxLDL and has been observed as a homodimer. |
| Molecular Mass : | ~33 kDa |
| AA Sequence : | NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS |
| Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
| Notes : | For research use only, not for use in diagnostic procedure. |
| Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
| Concentration : | ≥0.5 mg/mL |
| Storage Buffer : | PBS, 4M Urea, pH7.4 |
| Gene Name | CD68 CD68 molecule [ Homo sapiens (human) ] |
| Official Symbol | CD68 |
| Synonyms | CD68; CD68 molecule; CD68 antigen; macrosialin; DKFZp686M18236; GP110; LAMP4; macrophage antigen CD68; SCARD1; scavenger receptor class D; member 1; scavenger receptor class D, member 1; |
| Gene ID | 968 |
| mRNA Refseq | NM_001040059 |
| Protein Refseq | NP_001035148 |
| MIM | 153634 |
| UniProt ID | P34810 |
| ◆ Recombinant Proteins | ||
| Cd68-6733M | Recombinant Mouse Cd68 protein, His & GST-tagged | +Inquiry |
| CD68-312H | Recombinant Human CD68 protein, Fc-tagged | +Inquiry |
| CD68-7135H | Recombinant Human CD68 Molecule, His-tagged | +Inquiry |
| CD68-2336M | Recombinant Mouse CD68 Protein (21-291 aa), His-tagged | +Inquiry |
| CD68-239H | Recombinant Human CD68, StrepII-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CD68-33H | Recombinant Human CD68 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD68-001HCL | Recombinant Human CD68 cell lysate | +Inquiry |
| CD68-1362RCL | Recombinant Rat CD68 cell lysate | +Inquiry |
| CD68-2291HCL | Recombinant Human CD68 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD68 Products
Required fields are marked with *
My Review for All CD68 Products
Required fields are marked with *
