Recombinant Human CD7 protein(26-180aa), His&Myc-tagged
| Cat.No. : | CD7-3928H |
| Product Overview : | Recombinant Human CD7 protein(P09564)(26-180aa), fused with N-terminal His and C-terminal Myc tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His&Myc |
| Protein Length : | 26-180aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 21.5 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP |
| Gene Name | CD7 CD7 molecule [ Homo sapiens ] |
| Official Symbol | CD7 |
| Synonyms | CD7; CD7 molecule; CD7 antigen (p41); T-cell antigen CD7; GP40; LEU 9; p41 protein; T cell antigen CD7; T cell leukemia antigen; Tp40; TP41; T-cell leukemia antigen; T-cell surface antigen Leu-9; LEU-9; |
| Gene ID | 924 |
| mRNA Refseq | NM_006137 |
| Protein Refseq | NP_006128 |
| MIM | 186820 |
| UniProt ID | P09564 |
| ◆ Recombinant Proteins | ||
| CD7-492H | Recombinant Human CD7 Protein (Ala26-Pro180), C-6×His-tagged | +Inquiry |
| Cd7-1790R | Recombinant Rat Cd7 protein, His & T7-tagged | +Inquiry |
| CD7-27506TH | Recombinant Human CD7 | +Inquiry |
| CD7-1452H | Recombinant Human CD7 Protein (Ala26-Pro180), His tagged | +Inquiry |
| CD7-3007H | Active Recombinant Human CD7 protein, Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD7-2607HCL | Recombinant Human CD7 cell lysate | +Inquiry |
| CD7-2518MCL | Recombinant Mouse CD7 cell lysate | +Inquiry |
| CD7-1368RCL | Recombinant Rat CD7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD7 Products
Required fields are marked with *
My Review for All CD7 Products
Required fields are marked with *
