Recombinant Human CD7 Protein, C-His-tagged
Cat.No. : | CD7-175H |
Product Overview : | Recombinant Human CD7 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | CD7 is a type-I transmembrane glycoprotein belonging to the immunoglobulin superfamily. CD7 is one of the earliest surface markers to be expressed on the surface of developing T cells and its expression is maintained throughout maturation of multiple T cell subsets and NK cells. Engagement of CD7 through binding its ligand, SECTM1, has been shown to promote tyrosine phosphorylation of its cytoplasmic domain, recruitment of PI3K, and delivery of costimulatory signals for T cell activation. While CD7 is expressed on normal T cells, it is also highly expressed in a variety of T cell malignancies, which has poised it as a potential target of immunotherapy. |
Molecular Mass : | ~17 kDa |
AA Sequence : | AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD7 CD7 molecule [ Homo sapiens (human) ] |
Official Symbol | CD7 |
Synonyms | CD7; CD7 molecule; CD7 antigen (p41); T-cell antigen CD7; GP40; LEU 9; p41 protein; T cell antigen CD7; T cell leukemia antigen; Tp40; TP41; T-cell leukemia antigen; T-cell surface antigen Leu-9; LEU-9; |
Gene ID | 924 |
mRNA Refseq | NM_006137 |
Protein Refseq | NP_006128 |
MIM | 186820 |
UniProt ID | P09564 |
◆ Recombinant Proteins | ||
CD7-2289H | Recombinant Human CD7, His-tagged | +Inquiry |
Cd7-1790R | Recombinant Rat Cd7 protein, His & T7-tagged | +Inquiry |
CD7-6834HF | Recombinant Full Length Human CD7 Protein | +Inquiry |
CD7-832H | Recombinant Human CD7 Protein, His-tagged | +Inquiry |
CD7-0832H | Recombinant Human CD7 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD7-2607HCL | Recombinant Human CD7 cell lysate | +Inquiry |
CD7-1368RCL | Recombinant Rat CD7 cell lysate | +Inquiry |
CD7-2518MCL | Recombinant Mouse CD7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD7 Products
Required fields are marked with *
My Review for All CD7 Products
Required fields are marked with *