Recombinant Human CD79A

Cat.No. : CD79A-27509TH
Product Overview : Recombinant fragment (amino acids 33-140) of Human CD79a with proprietary 26 kDa tag; 108 amino acids (Predicted MW 12.16 kDa), 37.51 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 108 amino acids
Description : The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.
Molecular Weight : 37.510kDa inclusive of tags
Tissue specificity : B-cells.
Biological activity : useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HClNote: Glutathione is reduced
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGT
Sequence Similarities : Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 ITAM domain.
Gene Name CD79A CD79a molecule, immunoglobulin-associated alpha [ Homo sapiens ]
Official Symbol CD79A
Synonyms CD79A; CD79a molecule, immunoglobulin-associated alpha; CD79A antigen (immunoglobulin associated alpha) , IGA; B-cell antigen receptor complex-associated protein alpha chain; MB 1;
Gene ID 973
mRNA Refseq NM_001783
Protein Refseq NP_001774
MIM 112205
Uniprot ID P11912
Chromosome Location 19q13.2
Pathway B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; BCR signaling pathway, organism-specific biosystem; Primary immunodeficiency, organism-specific biosystem;
Function transmembrane signaling receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD79A Products

Required fields are marked with *

My Review for All CD79A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon