Recombinant Human CD83 Protein, C-His-tagged

Cat.No. : CD83-180H
Product Overview : Recombinant Human CD83 Protein with C-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : CD83 is a single-transmembrane protein with a calculated molecular weight (MW) of 23 kDa, but due to heavy and differential glycosylation, its apparent MW ranges from 23 to 70 kDa. CD83 is predominantly expressed on mature dendritic cells (DCs) and has been used as a DC activation/maturation marker as its increased expression is correlated with upregulation of HLA class II antigen expression on DCs. CD83 is also expressed at a low level on lymphocytes and is upregulated upon lymphocyte activation. Thymic epithelial cells also express CD83, which is required for normal CD4+ T cell development. CD83 is also expressed as a soluble form (sCD83) that can be found in serum of healthy adults. sCD83 has been shown to negatively regulate immune response by lymphocytes.
Molecular Mass : ~14 kDa
AA Sequence : TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAE
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name CD83 CD83 molecule [ Homo sapiens (human) ]
Official Symbol CD83
Synonyms CD83; CD83 molecule; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily) , CD83 molecule; CD83 antigen; BL11; HB15; hCD83; B-cell activation protein; cell surface protein HB15; cell-surface glycoprotein; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily);
Gene ID 9308
mRNA Refseq NM_001040280
Protein Refseq NP_001035370
MIM 604534
UniProt ID Q01151

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD83 Products

Required fields are marked with *

My Review for All CD83 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon