Recombinant Human CD83 Protein, Fc-tagged
Cat.No. : | CD83-051H |
Product Overview : | Recombinant Human CD83 fused with Fc His tag at C-termina was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Description : | The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene. |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4 |
Molecular Mass : | 41.2kD |
AA Sequence : | TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK* |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | CD83 CD83 molecule [ Homo sapiens ] |
Official Symbol | CD83 |
Synonyms | CD83; CD83 molecule; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily) , CD83 molecule; CD83 antigen; BL11; HB15; hCD83; B-cell activation protein; cell surface protein HB15; cell-surface glycoprotein; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily); |
Gene ID | 9308 |
mRNA Refseq | NM_001040280 |
Protein Refseq | NP_001035370 |
MIM | 604534 |
UniProt ID | Q01151 |
◆ Recombinant Proteins | ||
CD83-234M | Active Recombinant Mouse CD83, MIgG2a Fc-tagged | +Inquiry |
RFL1351MF | Recombinant Full Length Mouse Cd83 Antigen(Cd83) Protein, His-Tagged | +Inquiry |
CD83-0965H | Recombinant Human CD83 Protein (Lys24-Val205), N-GST tagged | +Inquiry |
Cd83-701M | Recombinant Mouse Cd83 Protein, His-tagged | +Inquiry |
CD83-150H | Recombinant Human CD83, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD83-1130CCL | Recombinant Cynomolgus CD83 cell lysate | +Inquiry |
CD83-2095HCL | Recombinant Human CD83 cell lysate | +Inquiry |
CD83-1845MCL | Recombinant Mouse CD83 cell lysate | +Inquiry |
CD83-1432RCL | Recombinant Rat CD83 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD83 Products
Required fields are marked with *
My Review for All CD83 Products
Required fields are marked with *