Recombinant Human CD9 protein, His&Myc-tagged

Cat.No. : CD9-6464H
Product Overview : Recombinant Human CD9 protein(P21926)(112-195aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 112-195aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 17.1 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
Gene Name CD9 CD9 molecule [ Homo sapiens ]
Official Symbol CD9
Synonyms CD9; CD9 molecule; CD9 antigen (p24) , MIC3; CD9 antigen; BA2; motility related protein 1; MRP 1; P24; TSPAN29; 5H9 antigen; tetraspanin-29; BA-2/p24 antigen; CD9 antigen (p24); leukocyte antigen MIC3; motility related protein-1; cell growth-inhibiting gene 2 protein; MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN-29; FLJ99568;
Gene ID 928
mRNA Refseq NM_001769
Protein Refseq NP_001760
MIM 143030
UniProt ID P21926

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD9 Products

Required fields are marked with *

My Review for All CD9 Products

Required fields are marked with *

0
cart-icon