| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
The CD93 antigen is a 652 amino acid cell-surface glycoprotein expressed by monocytes, neutrophils, platelets, microglia, and endothelial cells. CD93 was originally thought to be a putative receptor for the complement component C1q, a serum glycoprotein which plays an integral role in the activation of the classical pathway in response to immune complexes. As a result, in the literature the CD93 gene product has also been referred to as C1QR1 and C1qRp as well as MXRA4 (matrix-remodeling-associated protein 4). Recent studies suggest that the CD93 antigen plays a role in intercellular adhesion and in clearance of apoptotic cells. CD93 is a heavily O-glycosylated, type I transmembrane protein consisting of an N-terminal domain with homology to C-type Lectin domains, a tandem array of EGF-like domains, a single transmembrane domain and a short cytoplasmic tail. |
| Molecular Mass : |
~62 kDa |
| AA Sequence : |
ADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQK |
| Purity : |
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
| Notes : |
For research use only, not for use in diagnostic procedure. |
| Storage : |
Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
| Concentration : |
≥0.5 mg/mL |
| Storage Buffer : |
PBS, 4M Urea, pH7.4 |