Recombinant Human CD93 Protein, His-tagged

Cat.No. : CD93-037H
Product Overview : Recombinant Human CD93 Protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : The CD93 antigen is a 652 amino acid cell-surface glycoprotein expressed by monocytes, neutrophils, platelets, microglia, and endothelial cells. CD93 was originally thought to be a putative receptor for the complement component C1q, a serum glycoprotein which plays an integral role in the activation of the classical pathway in response to immune complexes. As a result, in the literature the CD93 gene product has also been referred to as C1QR1 and C1qRp as well as MXRA4 (matrix-remodeling-associated protein 4). Recent studies suggest that the CD93 antigen plays a role in intercellular adhesion and in clearance of apoptotic cells. CD93 is a heavily O-glycosylated, type I transmembrane protein consisting of an N-terminal domain with homology to C-type Lectin domains, a tandem array of EGF-like domains, a single transmembrane domain and a short cytoplasmic tail.
Molecular Mass : ~62 kDa
AA Sequence : ADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQK
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name CD93 CD93 molecule [ Homo sapiens (human) ]
Official Symbol CD93
Synonyms CD93; CD93 molecule; C1QR1, CD93 antigen , complement component 1, q subcomponent, receptor 1 , matrix remodelling associated 4 , MXRA4; complement component C1q receptor; C1qR(P); C1qRP; CDw93; dJ737E23.1; ECSM3; C1qR; CD93 antigen; C1q receptor 1; C1q/MBL/SPA receptor; matrix-remodelling associated 4; matrix-remodeling-associated protein 4; complement component 1 q subcomponent receptor 1; complement component 1, q subcomponent, receptor 1; C1QR1; MXRA4;
Gene ID 22918
mRNA Refseq NM_012072
Protein Refseq NP_036204
MIM 120577
UniProt ID Q9NPY3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD93 Products

Required fields are marked with *

My Review for All CD93 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon